Carbonic Anhydrase I/CA1 Antibody (0G10F8) Summary
| Description |
Novus Biologicals Rabbit Carbonic Anhydrase I/CA1 Antibody (0G10F8) (NBP3-16404) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human Carbonic Anhydrase I/CA1 (NP_001729.1). KVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Carbonic Anhydrase I/CA1 Antibody (0G10F8)
Background
Carbonic anhydrase performs an important role in respiration by facilitating transfer of CO2. Carbonic Anhydrase I (CAI) is a single polypeptide chain metalloenzyme of molecular weight 29 kDa. It is present mainly in erythrocytes at a concentration of about 12 mg per gram haemoglobin. Its main enzyme function is to catalyse the reversible hydration of carbon dioxide. It also catalyses the hydrolysis of certain esters. The twelve active CA isozymes are thought to regulate a variety of cellular functions including several processes in the reproductive systems. A mutational deficiency has been described but patients exhibit no adverse chemical symptoms. Red cell CAI levels are decreased in patients with thyrotoxicosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for Carbonic Anhydrase I/CA1 Antibody (NBP3-16404) (0)
There are no publications for Carbonic Anhydrase I/CA1 Antibody (NBP3-16404).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Carbonic Anhydrase I/CA1 Antibody (NBP3-16404) (0)
There are no reviews for Carbonic Anhydrase I/CA1 Antibody (NBP3-16404).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Carbonic Anhydrase I/CA1 Antibody (NBP3-16404) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Carbonic Anhydrase I/CA1 Products
Research Areas for Carbonic Anhydrase I/CA1 Antibody (NBP3-16404)
Find related products by research area.
|
Blogs on Carbonic Anhydrase I/CA1