Calretinin Antibody

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining in human testis and skeletal muscle tissues using NBP1-88221 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebellum, skeletal muscle, stomach and testis using Anti-CALB2 antibody NBP1-88221 (A) shows similar protein distribution across tissues to independent antibody NBP1-88220 (B).

Western Blot: Calretinin Antibody [NBP1-88221] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-88221] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Western Blot: Calretinin Antibody [NBP1-88221] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hippocampus shows selective immunoreactivity in the dentate gyrus neurons.

Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hypothalamus shows immunoreactivity in neurons of the paraventricular nucleus.

Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse substantia nigra shows neuronal cell bodies and processes in pars compacta.

Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hindbrain shows cytoplasmic immunoreactivity in neurons of the pontine nucleus.

Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse medulla shows positivity in the gigantocellular reticular nucleus neurons.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in cells in granular layer.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Calretinin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV
• Marker: Mesothelial Cell Marker
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry Free-Floating
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC-Free Floating reported in scientific literature (PMID: 31481399).
• Control Peptide:

  Calretinin Protein (NBP1-88221PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19351664).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Calretinin Antibody

• 29 kDa calbindin
• CAB29
• CAL2
• CALB2
• calbindin 2
• calbindin 2, (29kD, calretinin)
• calbindin 2, 29kDa (calretinin)
• calbindin D29K
• Calretinin
• CR

Background

Calretinin (CAB29, calbindin 2) is a calcium binding protein that belongs to calbindin family. It is mainly found in neuronal tissue, high expressed in auditory neurons. It has been implicated in as a calcium buffer, calcium sensor, and as a regulator of apoptosis (1). Calretinin is considered as a specific marker of mesothelllal cells; it is the only marker that has the utility in distinguishing between sarcomatoid mesotheliomas and sarcomatoid renal cell carcinomas (2). It is widely used in the panel of makers for distinguishing mesothlioma from adenocarcinoma. Along with calretinin, the panel includes E-cadherin, CEA, and cytokeratin 5/6 (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calretinin Antibody (NBP1-88221)(2)

Publications using NBP1-88221

• Papathanou M, Dumas S, Pettersson H et al. Off-Target Effects in Transgenic Mice: Characterization of Dopamine Transporter (DAT)-Cre Transgenic Mouse Lines Exposes Multiple Non-Dopaminergic Neuronal Clusters Available for Selective Targeting within Limbic Neurocircuitry eNeuro. 2019-10-31 [PMID: 31481399] (IHC-FrFl, Mouse)
• Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009-07-01 [PMID: 19351664]

Bioinformatics

• Gene Symbol: CALB2