Calretinin Antibody

Images

 
Genetic Strategies: Western Blot: Calretinin Antibody [NBP1-88221] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: Calretinin Antibody [NBP1-88221] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining in human testis and skeletal muscle tissues using NBP1-88221 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.
Western Blot: Calretinin Antibody [NBP1-88221] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hippocampus shows selective immunoreactivity in the dentate gyrus neurons.
Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hypothalamus shows immunoreactivity in neurons of the paraventricular nucleus.
Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse substantia nigra shows neuronal cell bodies and processes in pars compacta.
Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hindbrain shows cytoplasmic immunoreactivity in neurons of the pontine nucleus.
Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse medulla shows positivity in the gigantocellular reticular nucleus neurons.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in cells in granular layer.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebellum, skeletal muscle, stomach and testis using Anti-CALB2 antibody NBP1-88221 (A) shows similar protein distribution across ...read more
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IHC-FrFl, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Calretinin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV
Marker
Mesothelial Cell Marker
Specificity
Specificity of human Calretinin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunohistochemistry Free-Floating
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunohistochemistry free floating reported in scientific literature (PMID: 31481399).
Control Peptide
Calretinin Protein (NBP1-88221PEP)
Publications
Read Publications using
NBP1-88221 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19351664)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calretinin Antibody

  • 29 kDa calbindin
  • CAB29
  • CAL2
  • CALB2
  • calbindin 2
  • calbindin 2, (29kD, calretinin)
  • calbindin 2, 29kDa (calretinin)
  • calbindin D29K
  • Calretinin
  • CR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
AF1107
Species: Mu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: WB, IHC, IHC-P
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67691
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-61764
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88221
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl, KD

Publications for Calretinin Antibody (NBP1-88221)(2)

Reviews for Calretinin Antibody (NBP1-88221) (0)

There are no reviews for Calretinin Antibody (NBP1-88221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calretinin Antibody (NBP1-88221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Calretinin Products

Bioinformatics Tool for Calretinin Antibody (NBP1-88221)

Discover related pathways, diseases and genes to Calretinin Antibody (NBP1-88221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calretinin Antibody (NBP1-88221)

Discover more about diseases related to Calretinin Antibody (NBP1-88221).
 

Pathways for Calretinin Antibody (NBP1-88221)

View related products by pathway.

PTMs for Calretinin Antibody (NBP1-88221)

Learn more about PTMs related to Calretinin Antibody (NBP1-88221).
 

Research Areas for Calretinin Antibody (NBP1-88221)

Find related products by research area.

Blogs on Calretinin.

Using RPE65 as a tool to investigate ocular gene therapies
While not life threatening, blindness and retinal disease are profoundly debilitating and greatly affect quality of life.  Understandably, gene therapy has been subject to controversy given it’s potential effects on the rest of our cellular...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calretinin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALB2