Calretinin Antibody

Images

 
Western Blot: Calretinin Antibody [NBP1-88221] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebellum tissue
Immunocytochemistry/ Immunofluorescence: Calretinin Antibody [NBP1-88221] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells and strong nuclear positivity in cells in molecular layer.
Western Blot: Calretinin Antibody [NBP1-88221] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Western Blot: Calretinin Antibody [NBP1-88221] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: Calretinin Antibody [NBP1-88221] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of mouse hippocampus shows selective immunoreactivity in the dentate gyrus neurons.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of mouse hypothalamus shows immunoreactivity in neurons of the paraventricular nucleus.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of mouse substantia nigra shows neuronal cell bodies and processes in pars compacta.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of mouse hindbrain shows cytoplasmic immunoreactivity in neurons of the pontine nucleus.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of mouse medulla shows positivity in the gigantocellular reticular nucleus neurons.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human hippocampus shows strong cytoplasmic positivity in s subset of neurons.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebral cortex shows strong cytoplasmic immunoreactivity in a subset of neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calretinin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV
Marker
Mesothelial Cell Marker
Specificity
Specificity of human, mouse Calretinin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Calretinin Protein (NBP1-88221PEP)
Publications
Read Publication using NBP1-88221.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19351664)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calretinin Antibody

  • 29 kDa calbindin
  • CAB29
  • CAL2
  • CALB2
  • calbindin 2
  • calbindin 2, (29kD, calretinin)
  • calbindin 2, 29kDa (calretinin)
  • calbindin D29K
  • Calretinin
  • CR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
H00347527-P01
Species: Hu
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-88221
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Calretinin Antibody (NBP1-88221)(1)

Reviews for Calretinin Antibody (NBP1-88221) (0)

There are no reviews for Calretinin Antibody (NBP1-88221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calretinin Antibody (NBP1-88221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Calretinin Antibody (NBP1-88221)

Discover related pathways, diseases and genes to Calretinin Antibody (NBP1-88221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calretinin Antibody (NBP1-88221)

Discover more about diseases related to Calretinin Antibody (NBP1-88221).
 

Pathways for Calretinin Antibody (NBP1-88221)

View related products by pathway.

PTMs for Calretinin Antibody (NBP1-88221)

Learn more about PTMs related to Calretinin Antibody (NBP1-88221).
 

Research Areas for Calretinin Antibody (NBP1-88221)

Find related products by research area.

Blogs on Calretinin.

Using RPE65 as a tool to investigate ocular gene therapies
While not life threatening, blindness and retinal disease are profoundly debilitating and greatly affect quality of life.  Understandably, gene therapy has been subject to controversy given it’s potential effects on the rest of our cellular...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calretinin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALB2
Entrez