Calpain 10 Antibody

Images

 
Western Blot: Calpain 10 Antibody [NBP1-87489] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: Calpain 10 Antibody [NBP1-87489] - Staining of human cell line A-431 shows positivity in mitochondria.
Immunohistochemistry-Paraffin: Calpain 10 Antibody [NBP1-87489] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calpain 10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGGQQDRPGRWEHRTCRQLLHLKDQCLISCCVLSPRAGARELGEFHAFIVSDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAPN10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Calpain 10 Protein (NBP1-87489PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calpain 10 Antibody

  • Calcium-activated neutral proteinase 10
  • calpain 10
  • calpain-10
  • calpain-like protease CAPN10
  • CANP 10
  • CANP10
  • EC 3.4.22.-
  • KIAA1845
  • NIDDM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
H00000726-P01
Species: Hu
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF2009
Species: Hu
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87489
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Calpain 10 Antibody (NBP1-87489) (0)

There are no publications for Calpain 10 Antibody (NBP1-87489).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 10 Antibody (NBP1-87489) (0)

There are no reviews for Calpain 10 Antibody (NBP1-87489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calpain 10 Antibody (NBP1-87489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calpain 10 Products

Bioinformatics Tool for Calpain 10 Antibody (NBP1-87489)

Discover related pathways, diseases and genes to Calpain 10 Antibody (NBP1-87489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain 10 Antibody (NBP1-87489)

Discover more about diseases related to Calpain 10 Antibody (NBP1-87489).
 

Pathways for Calpain 10 Antibody (NBP1-87489)

View related products by pathway.

PTMs for Calpain 10 Antibody (NBP1-87489)

Learn more about PTMs related to Calpain 10 Antibody (NBP1-87489).

Blogs on Calpain 10

There are no specific blogs for Calpain 10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calpain 10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPN10