Cadherin-17 Antibody - BSA Free

Analysis in human cell lines Caco-2 and A-431 using Anti-CDH17 antibody. Corresponding CDH17 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Analysis in human duodenum and liver tissues using NBP1-88238 antibody. Corresponding Cadherin-17 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Staining of human duodenum shows strong membranous positivity in glandular cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Staining of human kidney shows no positivity in cells in tubules as expected.

Staining of human colon, duodenum, kidney and liver using NBP1-88238 (A) shows similar protein distribution across tissues to independent antibody NBP1-88239 (B).

Staining of human colon shows strong membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cadherin-17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cadherin-17 Antibody - BSA Free (NBP1-88238) is a polyclonal antibody validated for use in IHC and WB. Anti-Cadherin-17 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDH17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cadherin-17 Protein (NBP1-88238PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cadherin-17 Antibody - BSA Free

• cadherin 17, LI cadherin (liver-intestine)
• cadherin
• cadherin-16
• Cadherin17
• Cadherin-17
• CDH16
• CDH17
• FLJ26931
• HPT-1 cadherin
• HPT1
• HPT-1
• human intestinal peptide-associated transporter HPT-1
• human peptide transporter 1
• Intestinal peptide-associated transporter HPT-1
• LI cadherin
• LI-cadherin
• Liver-intestine cadherin
• MGC138218
• MGC142024

Background

LI Cadherin is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cadherin-17 Antibody (NBP1-88238)(1)

Publication using NBP1-88238

• Magnusson K, de Wit M, Brennan DJ et al. SATB2 in combination with cytokeratin 20 identifies over 95% of all colorectal carcinomas. Am J Surg Pathol 2011-07-01 [PMID: 21677534]

Bioinformatics

• Gene Symbol: CDH17