Cadherin-17 Antibody


Orthogonal Strategies: Western Blot: Cadherin-17 Antibody [NBP1-88238] - Analysis in human cell lines Caco-2 and A-431 using anti-CDH17 antibody. Corresponding CDH17 RNA-seq data are presented for the same cell more
Immunocytochemistry/ Immunofluorescence: Cadherin-17 Antibody [NBP1-88238] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Staining in human duodenum and liver tissues using anti-CDH17 antibody. Corresponding CDH17 RNA-seq data are presented for more
Western Blot: Cadherin-17 Antibody [NBP1-88238] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate more
Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Staining of human duodenum shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88238] - Staining of human liver shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Cadherin-17 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK
Specificity of human Cadherin-17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cadherin-17 Protein (NBP1-88238PEP)
Read Publication using NBP1-88238.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cadherin-17 Antibody

  • cadherin 17, LI cadherin (liver-intestine)
  • cadherin
  • cadherin-16
  • Cadherin17
  • Cadherin-17
  • CDH16
  • CDH17
  • FLJ26931
  • HPT-1 cadherin
  • HPT1
  • HPT-1
  • human intestinal peptide-associated transporter HPT-1
  • human peptide transporter 1
  • Intestinal peptide-associated transporter HPT-1
  • LI cadherin
  • LI-cadherin
  • Liver-intestine cadherin
  • MGC138218
  • MGC142024


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Cadherin-17 Antibody (NBP1-88238)(1)

Reviews for Cadherin-17 Antibody (NBP1-88238) (0)

There are no reviews for Cadherin-17 Antibody (NBP1-88238). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cadherin-17 Antibody (NBP1-88238) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cadherin-17 Products

Bioinformatics Tool for Cadherin-17 Antibody (NBP1-88238)

Discover related pathways, diseases and genes to Cadherin-17 Antibody (NBP1-88238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-17 Antibody (NBP1-88238)

Discover more about diseases related to Cadherin-17 Antibody (NBP1-88238).

Pathways for Cadherin-17 Antibody (NBP1-88238)

View related products by pathway.

PTMs for Cadherin-17 Antibody (NBP1-88238)

Learn more about PTMs related to Cadherin-17 Antibody (NBP1-88238).

Research Areas for Cadherin-17 Antibody (NBP1-88238)

Find related products by research area.

Blogs on Cadherin-17

There are no specific blogs for Cadherin-17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cadherin-17 Antibody and receive a gift card or discount.


Gene Symbol CDH17