CABYR Antibody

Images

 
Western Blot: CABYR Antibody [NBP2-14430] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CABYR Antibody [NBP2-14430] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CABYR Antibody [NBP2-14430] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CABYR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKS VVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CABYR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CABYR Protein (NBP2-14430PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CABYR Antibody

  • CABYRa
  • CABYRc
  • calcium binding tyrosine-(Y)-phosphorylation regulated
  • Calcium-binding protein 86
  • calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)
  • Cancer/testis antigen 88
  • CBP86CABYRc/d
  • CT88MGC9117
  • fibrousheathin 2
  • Fibrousheathin II
  • fibrousheathin-2
  • FSP-2calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)
  • FSP2calcium-binding tyrosine phosphorylation-regulated protein
  • Testis-specific calcium-binding protein CBP86

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

21050002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56418
Species: Hu
Applications: IHC, IHC-P
NBP1-89173
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
9094-AG
Species: Hu
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for CABYR Antibody (NBP2-14430) (0)

There are no publications for CABYR Antibody (NBP2-14430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABYR Antibody (NBP2-14430) (0)

There are no reviews for CABYR Antibody (NBP2-14430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CABYR Antibody (NBP2-14430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CABYR Products

Bioinformatics Tool for CABYR Antibody (NBP2-14430)

Discover related pathways, diseases and genes to CABYR Antibody (NBP2-14430). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CABYR Antibody (NBP2-14430)

Discover more about diseases related to CABYR Antibody (NBP2-14430).
 

Pathways for CABYR Antibody (NBP2-14430)

View related products by pathway.

PTMs for CABYR Antibody (NBP2-14430)

Learn more about PTMs related to CABYR Antibody (NBP2-14430).
 

Research Areas for CABYR Antibody (NBP2-14430)

Find related products by research area.

Blogs on CABYR

There are no specific blogs for CABYR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CABYR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CABYR