CABYR Antibody

Images

 
Western Blot: CABYR Antibody [NBP2-14430] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CABYR Antibody [NBP2-14430] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CABYR Antibody [NBP2-14430] - Staining in human testis and endometrium tissues using anti-CABYR antibody. Corresponding CABYR RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: CABYR Antibody [NBP2-14430] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: CABYR Antibody [NBP2-14430] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CABYR Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: YNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CABYR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CABYR Protein (NBP2-14430PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CABYR Antibody

  • CABYRa
  • CABYRc
  • calcium binding tyrosine-(Y)-phosphorylation regulated
  • Calcium-binding protein 86
  • calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)
  • Cancer/testis antigen 88
  • CBP86CABYRc/d
  • CT88MGC9117
  • fibrousheathin 2
  • Fibrousheathin II
  • fibrousheathin-2
  • FSP-2calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)
  • FSP2calcium-binding tyrosine phosphorylation-regulated protein
  • Testis-specific calcium-binding protein CBP86

Background

To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Transcript variants of this gene encode multiple protein isoforms. An additional transcript and isoform has not been fully characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00054763-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-85409
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47299
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89173
Species: Hu
Applications: IHC, IHC-P
H00051062-M03
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00006275-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP2-14040
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-31754
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89172
Species: Hu
Applications: IHC, IHC-P, WB
9094-AG
Species: Hu
Applications: BA
NBP1-90271
Species: Hu
Applications: IHC, IHC-P, WB
DFN00
Species: Hu
Applications: ELISA
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-14430
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for CABYR Antibody (NBP2-14430) (0)

There are no publications for CABYR Antibody (NBP2-14430).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABYR Antibody (NBP2-14430) (0)

There are no reviews for CABYR Antibody (NBP2-14430). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CABYR Antibody (NBP2-14430) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CABYR Products

Diseases for CABYR Antibody (NBP2-14430)

Discover more about diseases related to CABYR Antibody (NBP2-14430).
 

Pathways for CABYR Antibody (NBP2-14430)

View related products by pathway.

PTMs for CABYR Antibody (NBP2-14430)

Learn more about PTMs related to CABYR Antibody (NBP2-14430).
 

Research Areas for CABYR Antibody (NBP2-14430)

Find related products by research area.

Blogs on CABYR

There are no specific blogs for CABYR, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CABYR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CABYR