ROPN1 Antibody (4E11)

Images

 
Immunohistochemistry-Paraffin: ROPN1 Antibody (4E11) [H00054763-M03] - Analysis of monoclonal antibody to ROPN1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 1.5 ug/ml
ELISA: ROPN1 Antibody (4E11) [H00054763-M03] - Detection limit for recombinant GST tagged ROPN1 is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
4E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ROPN1 Antibody (4E11) Summary

Immunogen
ROPN1 (AAH15413, 1 a.a. ~ 120 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Specificity
ROPN1 - ropporin, rhophilin associated protein 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ROPN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publication using H00054763-M03.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ROPN1 Antibody (4E11)

  • Cancer/testis antigen 91
  • CT91Rhophilin-associated protein 1A
  • ODF6RHPNAP1
  • outer dense fiber of sperm tails 6
  • rhophilin associated tail protein 1
  • ROPN1ADKFZp434B1222
  • ropporin
  • ropporin, rhophilin associated protein 1
  • ropporin-1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89173
Species: Hu
Applications: IHC, IHC-P
NBP1-85409
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14430
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90081
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-89172
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP1-82881
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14040
Species: Hu
Applications: IHC, IHC-P, WB
DFN00
Species: Hu
Applications: ELISA
NB100-41371
Species: Ma, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP1-31754
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
9094-AG
Species: Hu
Applications: BA
NBP1-90271
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for ROPN1 Antibody (H00054763-M03)(1)


Reviews for ROPN1 Antibody (H00054763-M03) (0)

There are no reviews for ROPN1 Antibody (H00054763-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ROPN1 Antibody (H00054763-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ROPN1 Products

Bioinformatics Tool for ROPN1 Antibody (H00054763-M03)

Discover related pathways, diseases and genes to ROPN1 Antibody (H00054763-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROPN1 Antibody (H00054763-M03)

Discover more about diseases related to ROPN1 Antibody (H00054763-M03).
 

Pathways for ROPN1 Antibody (H00054763-M03)

View related products by pathway.

PTMs for ROPN1 Antibody (H00054763-M03)

Learn more about PTMs related to ROPN1 Antibody (H00054763-M03).

Blogs on ROPN1

There are no specific blogs for ROPN1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROPN1 Antibody (4E11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ROPN1
Entrez
Uniprot