AKAP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AKAP3 Antibody [NBP1-89173] - Staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm, golgi apparatus and vesicles.
Immunohistochemistry-Paraffin: AKAP3 Antibody [NBP1-89173] - Staining of human testis shows moderate cytoplasmic positivity in spermatids.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AQGGRRDARSFVEAAGTTNFPANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCERP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AKAP3 Protein (NBP1-89173PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKAP3 Antibody

  • A kinase (PRKA) anchor protein 3
  • AKAP110AKAP 110
  • AKAP-3
  • A-kinase anchor protein 110 kDa
  • Cancer/testis antigen 82
  • CT82A-kinase anchor protein 3
  • Fibrous sheath protein of 95 kDa
  • fibrousheathin 1
  • Fibrousheathin I
  • fibrousheathin-1
  • FSP95A-kinase anchor protein, 110kDa
  • PRKA3
  • protein kinase A anchoring protein 3
  • Protein kinase A-anchoring protein 3
  • SOB1fibrous sheath protein, 95kDa
  • sperm oocyte-binding protein 1
  • Sperm oocyte-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89165
Species: Hu
Applications: IHC, IHC-P
21050002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-45545
Species: Hu
Applications: WB, IHC
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF

Publications for AKAP3 Antibody (NBP1-89173) (0)

There are no publications for AKAP3 Antibody (NBP1-89173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP3 Antibody (NBP1-89173) (0)

There are no reviews for AKAP3 Antibody (NBP1-89173). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AKAP3 Antibody (NBP1-89173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKAP3 Products

AKAP3 NBP1-89173

Bioinformatics Tool for AKAP3 Antibody (NBP1-89173)

Discover related pathways, diseases and genes to AKAP3 Antibody (NBP1-89173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP3 Antibody (NBP1-89173)

Discover more about diseases related to AKAP3 Antibody (NBP1-89173).
 

Pathways for AKAP3 Antibody (NBP1-89173)

View related products by pathway.

PTMs for AKAP3 Antibody (NBP1-89173)

Learn more about PTMs related to AKAP3 Antibody (NBP1-89173).

Blogs on AKAP3

There are no specific blogs for AKAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP3