C4 binding protein A Antibody

Images

 
Western Blot: C4 binding protein A Antibody [NBP1-88263] - Analysis in human plasma.
Independent Antibodies: Immunohistochemistry-Paraffin: C4 binding protein A Antibody [NBP1-88263] - Staining of human colon, kidney, liver and lung using Anti-C4BPA antibody NBP1-88263 (A) shows similar protein ...read more
Western Blot: C4 binding protein A Antibody [NBP1-88263] - Analysis in human cell line RT-4, human cell line U-251 MG, human cell line A-431, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: C4 binding protein A Antibody [NBP1-88263] - Staining of human liver using Anti-C4BPA antibody.
Immunohistochemistry-Paraffin: C4 binding protein A Antibody [NBP1-88263] - Staining of human lung using Anti-C4BPA antibody.
Immunohistochemistry-Paraffin: C4 binding protein A Antibody [NBP1-88263] - Staining of human kidney using Anti-C4BPA antibody.
Immunohistochemistry-Paraffin: C4 binding protein A Antibody [NBP1-88263] - Staining of human colon using Anti-C4BPA antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

C4 binding protein A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C4BPA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C4 binding protein A Protein (NBP1-88263PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C4 binding protein A Antibody

  • C4b binding protein, alpha chain
  • C4b-binding protein alpha chain
  • C4BP
  • complement component 4 binding protein, alpha chain
  • complement component 4 binding protein, alpha
  • complement component 4-binding protein, alpha
  • Proline-rich protein
  • PRP

Background

C4 binding protein A encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-81078
Species: Ha, Hu
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
AF4779
Species: Hu
Applications: IHC, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-57177
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
137-PS
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-62583
Species: Hu
Applications: WB

Publications for C4 binding protein A Antibody (NBP1-88263) (0)

There are no publications for C4 binding protein A Antibody (NBP1-88263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C4 binding protein A Antibody (NBP1-88263) (0)

There are no reviews for C4 binding protein A Antibody (NBP1-88263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C4 binding protein A Antibody (NBP1-88263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C4 binding protein A Products

Bioinformatics Tool for C4 binding protein A Antibody (NBP1-88263)

Discover related pathways, diseases and genes to C4 binding protein A Antibody (NBP1-88263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C4 binding protein A Antibody (NBP1-88263)

Discover more about diseases related to C4 binding protein A Antibody (NBP1-88263).
 

Pathways for C4 binding protein A Antibody (NBP1-88263)

View related products by pathway.

PTMs for C4 binding protein A Antibody (NBP1-88263)

Learn more about PTMs related to C4 binding protein A Antibody (NBP1-88263).
 

Research Areas for C4 binding protein A Antibody (NBP1-88263)

Find related products by research area.

Blogs on C4 binding protein A

There are no specific blogs for C4 binding protein A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C4 binding protein A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C4BPA