C11orf96 Antibody

Immunocytochemistry/Immunofluorescence: C11orf96 Antibody [NBP1-90866] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: C11orf96 Antibody [NBP1-90866] - Staining of human small intestine shows strong granular positivity in cytoplasm in glandular cells.

Immunohistochemistry-Paraffin: C11orf96 Antibody [NBP1-90866] - Staining of human endometrium shows strong granular positivity in cytoplasm in glandular cells.

Immunohistochemistry-Paraffin: C11orf96 Antibody [NBP1-90866] - Staining of human skeletal muscle shows very weak positivity in myocytes.

Immunohistochemistry-Paraffin: C11orf96 Antibody [NBP1-90866] - Staining of human prostate shows strong granular positivity in cytoplasm in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

C11orf96 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSCKLRNSLDSS
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C11ORF96
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  C11orf96 Protein (NBP1-90866PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C11orf96 Antibody

• AG2
• chromosome 11 open reading frame 96
• protein Ag2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C11ORF96