C11orf96 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C11orf96 Antibody [NBP1-90866] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: C11orf96 Antibody [NBP1-90866] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C11orf96 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSCKLRNSLDSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C11ORF96
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C11orf96 Protein (NBP1-90866PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C11orf96 Antibody

  • AG2
  • chromosome 11 open reading frame 96
  • protein Ag2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52446
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: WB, ELISA, IHC, IHC-P, ICC
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-20940
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-90866
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for C11orf96 Antibody (NBP1-90866) (0)

There are no publications for C11orf96 Antibody (NBP1-90866).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C11orf96 Antibody (NBP1-90866) (0)

There are no reviews for C11orf96 Antibody (NBP1-90866). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C11orf96 Antibody (NBP1-90866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C11orf96 Products

Bioinformatics Tool for C11orf96 Antibody (NBP1-90866)

Discover related pathways, diseases and genes to C11orf96 Antibody (NBP1-90866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C11orf96

There are no specific blogs for C11orf96, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C11orf96 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C11ORF96