We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

Images

 
Immunoprecipitation: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] - Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug Adenine Nucleotide Translocase 1 antibody. Western blot was ...read more
Western Blot: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] - Western blot analysis of various lysates using [KO Validated] Adenine Nucleotide Translocase 1 Rabbit mAb at1:1000 dilution.
Secondary ...read more
Western Blot: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] - Western blot analysis of lysates from MCF7 cells, using [KO Validated] Adenine Nucleotide Translocase 1 Rabbit mAb at1:1000 ...read more
Genetic Strategies: Immunocytochemistry/ Immunofluorescence: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] - Confocal imaging of HeLa cells using [KO Validated] SLC25A4/ANT1 Rabbit mAb. The ...read more
Genetic Strategies: Western Blot: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] - Western Blot analysis of lysates from wild type (WT) and Adenine Nucleotide Translocase 1 knockout (KO) 293T ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
3C1Q3
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Adenine Nucleotide Translocase 1 Antibody (3C1Q3) Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Adenine Nucleotide Translocase 1 (NP_001142.2).

Sequence:
LGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKG
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
SLC25A4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:1000
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

  • AAC1
  • Adenine nucleotide translocator 1
  • ADP
  • ADP/ATP translocase 1
  • ANT 1
  • ANT1adenine nucleotide translocator 1 (skeletal muscle)
  • ATP carrier protein 1
  • ATP carrier protein, heart/skeletal muscle isoform T1
  • ATP carrier protein, heart/skeletal muscle
  • heart/skeletal muscle ATP/ADP translocator
  • PEO2
  • PEO3
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4
  • Solute carrier family 25 member 4
  • T1ANT

Background

Adenine Nucleotide Translocase 1 (ANT1) catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It is is a key component of the mitochondrial permeability transition pore (PT pore) complex and is also one of the most abundant proteins in the mitochondrion making up approximately 10% of all mitochondrial proteins. Originally described as an ADP/ATP exchange factor, ANT1 has also been shown to be required for bax mediated apoptosis. This is effected by binding of bax to residues 105-156 of ANT1, presumably resulting in maintaining the PT pore in an open conformation. Interaction with bax is not required for ANT1 pro-apoptotic activity as overexpression of the ANT1 protein also leads to the induction of apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
MAB1455
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-20393
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC,  IHC-P, WB
NBP2-15079
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP3-32238
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-81038
Species: Bv, Hu, Po, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF3398
Applications: ICC, KO, Simple Western, WB
NBP3-35061
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP

Publications for Adenine Nucleotide Translocase 1 Antibody (NBP3-35061) (0)

There are no publications for Adenine Nucleotide Translocase 1 Antibody (NBP3-35061).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenine Nucleotide Translocase 1 Antibody (NBP3-35061) (0)

There are no reviews for Adenine Nucleotide Translocase 1 Antibody (NBP3-35061). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Adenine Nucleotide Translocase 1 Antibody (NBP3-35061) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenine Nucleotide Translocase 1 Products

Research Areas for Adenine Nucleotide Translocase 1 Antibody (NBP3-35061)

Find related products by research area.

Blogs on Adenine Nucleotide Translocase 1.

New Players in the Mitophagy Game
By Christina Towers, PhD Mitochondrial turn over via the lysosome, otherwise known as mitophagy, involves engulfment of mitochondria into double membrane autophagosomes and subsequent fusion with lysosomes. Much is al...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenine Nucleotide Translocase 1 Antibody (3C1Q3) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A4