c-Myb Recombinant Protein Antigen

Images

 
There are currently no images for c-Myb Recombinant Protein Antigen (NBP3-21349PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

c-Myb Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human c-Myb

Source: E.coli

Amino Acid Sequence: HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21349. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for c-Myb Recombinant Protein Antigen

  • c-myb protein (140 AA)
  • Cmyb
  • c-myb
  • c-myb_CDS
  • c-myb10A_CDS
  • c-myb13A_CDS
  • c-myb14A_CDS
  • c-myb8B_CDS
  • efg
  • Proto-oncogene c-Myb
  • transcriptional activator Myb
  • v-myb avian myeloblastosis viral oncogene homolog
  • v-myb myeloblastosis viral oncogene homolog (avian)

Background

The c-Myb proto-oncogene is a 75 kDa protein involved in growth regulation and differentiation in many different cell types but it is predominantly expressed in immature hemopoietic cells where it plays an important role in cell proliferation. c-Myb activity is directly regulated by cyclin D1 and CDKs and it is believed that c-Myb activity is regulated during the cell cycle in hematopoietic cells (2). Disrupting c-myb function might, therefore, prove an effective therapeutic strategy for controlling leukemic cell growth (3). c-Myb binds to promoter sequences of genes such as c-Myc or Bcl-2 that are expressed in cutaneous T-cell lymphoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00004605-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90171
Species: Hu, Mu
Applications: IHC,  IHC-P
202-IL
Species: Hu
Applications: BA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
MAB6979
Species: Hu
Applications: WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
MEP00B
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA

Publications for c-Myb Recombinant Protein Antigen (NBP3-21349PEP) (0)

There are no publications for c-Myb Recombinant Protein Antigen (NBP3-21349PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for c-Myb Recombinant Protein Antigen (NBP3-21349PEP) (0)

There are no reviews for c-Myb Recombinant Protein Antigen (NBP3-21349PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for c-Myb Recombinant Protein Antigen (NBP3-21349PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional c-Myb Products

Research Areas for c-Myb Recombinant Protein Antigen (NBP3-21349PEP)

Find related products by research area.

Blogs on c-Myb

There are no specific blogs for c-Myb, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our c-Myb Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYB