HN1L Antibody

Images

 
Western Blot: HN1L Antibody [NBP1-88446] - Analysis in human cell line TD47D.
Immunocytochemistry/ Immunofluorescence: HN1L Antibody [NBP1-88446] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HN1L Antibody [NBP1-88446] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: HN1L Antibody [NBP1-88446] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HN1L Antibody [NBP1-88446] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HN1L Antibody [NBP1-88446] - Staining of human placenta shows moderate cytoplamic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HN1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDI
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HN1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HN1L Protein (NBP1-88446PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HN1L Antibody

  • C16orf34
  • chromosome 16 open reading frame 34
  • CRAMP_1 like
  • FLJ13092
  • hematological and neurological expressed 1-like protein
  • hematological and neurological expressed 1-like
  • HN1 like
  • HN1-like protein
  • KIAA1426
  • L11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HN1L Antibody (NBP1-88446) (0)

There are no publications for HN1L Antibody (NBP1-88446).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HN1L Antibody (NBP1-88446) (0)

There are no reviews for HN1L Antibody (NBP1-88446). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HN1L Antibody (NBP1-88446) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HN1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HN1L