RRS1 Antibody

Images

 
Western Blot: RRS1 Antibody [NBP2-30725] - Analysis using Anti-RRS1 antibody NBP2-30725 (A) shows similar pattern to independent antibody NBP2-49323 (B).
Immunocytochemistry/ Immunofluorescence: RRS1 Antibody [NBP2-30725] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human pancreas shows moderate to strong positivity in nucleoli in exocrine glandular cells.
Western Blot: RRS1 Antibody [NBP2-30725] - Analysis in human cell lines PC-3 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry: RRS1 Antibody [NBP2-30725] - Staining of human vagina shows strong nucleolar positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human rectum shows strong positivity in nucleoli in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RRS1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKP
Specificity
Specificity of human RRS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RRS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RRS1 Protein (NBP2-30725PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RRS1 Antibody

  • FSDR2
  • homolog of yeast ribosome biogenesis regulator
  • homolog of yeast ribosome biogenesis regulatory protein RRS1
  • KIAA0112ribosome biogenesis regulatory protein RRS1 homolog
  • ribosome biogenesis regulatory protein homolog
  • RRR
  • RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-68925
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46580
Species: Hu
Applications: WB, IHC
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90327
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20224
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IHC
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-32109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
H00003836-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
7270-IL/CF
Species: Hu
NBP1-60052
Species: Hu
Applications: WB
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RRS1 Antibody (NBP2-30725) (0)

There are no publications for RRS1 Antibody (NBP2-30725).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRS1 Antibody (NBP2-30725) (0)

There are no reviews for RRS1 Antibody (NBP2-30725). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RRS1 Antibody (NBP2-30725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RRS1 Antibody (NBP2-30725)

Discover related pathways, diseases and genes to RRS1 Antibody (NBP2-30725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RRS1 Antibody (NBP2-30725)

Discover more about diseases related to RRS1 Antibody (NBP2-30725).
 

Pathways for RRS1 Antibody (NBP2-30725)

View related products by pathway.

Research Areas for RRS1 Antibody (NBP2-30725)

Find related products by research area.

Blogs on RRS1

There are no specific blogs for RRS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RRS1
Uniprot