![Western Blot: RRS1 Antibody [NBP2-30725] - Analysis in human cell lines PC-3 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/RRS1-Antibody-Western-Blot-NBP2-30725-img0006.jpg "Western Blot: RRS1 Antibody [NBP2-30725] - Analysis in human cell lines PC-3 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKP |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RRS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Yongkang Yang |
WB | 12/20/2023 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for RRS1 Antibody (NBP2-30725)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: RRS1 Antibody [NBP2-30725] - Analysis using Anti-RRS1 antibody NBP2-30725 (A) shows similar pattern to independent antibody NBP2-49323 (B).](http://images.novusbio.com/fullsize/RRS1-Antibody-Western-Blot-NBP2-30725-img0007.jpg "Western Blot: RRS1 Antibody [NBP2-30725] - Analysis using Anti-RRS1 antibody NBP2-30725 (A) shows similar pattern to independent antibody NBP2-49323 (B).")
![Immunocytochemistry/Immunofluorescence: RRS1 Antibody [NBP2-30725] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RRS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30725-img0005.jpg "Immunocytochemistry/Immunofluorescence: RRS1 Antibody [NBP2-30725] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human fallopian tube shows strong positivity in nucleoli in glandular cells.](http://images.novusbio.com/fullsize/RRS1-Antibody-Immunohistochemistry-Paraffin-NBP2-30725-img0011.jpg "Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human fallopian tube shows strong positivity in nucleoli in glandular cells.")
![Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human rectum shows strong positivity in nucleoli in glandular cells.](http://images.novusbio.com/fullsize/RRS1-Antibody-Immunohistochemistry-Paraffin-NBP2-30725-img0009.jpg "Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human rectum shows strong positivity in nucleoli in glandular cells.")
![Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human pancreas shows moderate to strong positivity in nucleoli in exocrine glandular cells.](http://images.novusbio.com/fullsize/RRS1-Antibody-Immunohistochemistry-Paraffin-NBP2-30725-img0008.jpg "Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human pancreas shows moderate to strong positivity in nucleoli in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human cerebral cortex shows moderate to strong positivity in nucleoli in a subset of neurons.](http://images.novusbio.com/fullsize/RRS1-Antibody-Immunohistochemistry-Paraffin-NBP2-30725-img0010.jpg "Immunohistochemistry-Paraffin: RRS1 Antibody [NBP2-30725] - Staining of human cerebral cortex shows moderate to strong positivity in nucleoli in a subset of neurons.")
![Western Blot: Rabbit Polyclonal RRS1 Antibody [NBP2-30725] - Whole cell lysates from MDA-MB-231, MCF-7, SUM149 and SUM159 cells were loaded with 50 ug/lane. 10% SDS-PAGE. RRS1 Antibody (NBP2-30725) was used for primary antibody: 1:1000, 4℃, overnight. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp2-30725_rabbit-polyclonal-rrs1-antibody-western-blot-3112024141420..jpg "Western Blot: Rabbit Polyclonal RRS1 Antibody [NBP2-30725] - Whole cell lysates from MDA-MB-231, MCF-7, SUM149 and SUM159 cells were loaded with 50 ug/lane. 10% SDS-PAGE. RRS1 Antibody (NBP2-30725) was used for primary antibody: 1:1000, 4℃, overnight. Image from a verified customer review.")
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
