BRMS1L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BRMS1L Antibody [NBP2-14362] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRMS1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRG QTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSK
Specificity
Specificity of human BRMS1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRMS1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000-1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P reactivity reported in (PMID: 25406648).
Control Peptide
Publications
Read Publication using NBP2-14362.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRMS1L Antibody

  • breast cancer metastasis-suppressor 1
  • breast cancer metastasis-suppressor 1-like protein
  • breast cancer metastasis-suppressor 1-like
  • BRMS1
  • BRMS1-homolog protein p40
  • BRMS1-like protein p40
  • FLJ39177
  • MGC11296

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
H00003814-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-21792
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-26616
Species: Hu
Applications: WB, IP
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24716
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056547-M01
Species: Hu
Applications: WB, ELISA
NBP2-46024
Species: Hu
Applications: WB, IHC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for BRMS1L Antibody (NBP2-14362)(1)

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
All Species

Reviews for BRMS1L Antibody (NBP2-14362) (0)

There are no reviews for BRMS1L Antibody (NBP2-14362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BRMS1L Antibody (NBP2-14362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BRMS1L Products

Bioinformatics Tool for BRMS1L Antibody (NBP2-14362)

Discover related pathways, diseases and genes to BRMS1L Antibody (NBP2-14362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRMS1L Antibody (NBP2-14362)

Discover more about diseases related to BRMS1L Antibody (NBP2-14362).

Research Areas for BRMS1L Antibody (NBP2-14362)

Find related products by research area.

Blogs on BRMS1L

There are no specific blogs for BRMS1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRMS1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRMS1L