BRMS1 Antibody (5Y8J3)

Immunohistochemistry: BRMS1 Antibody (5Y8J3) [NBP3-33186] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using BRMS1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: BRMS1 Antibody (5Y8J3) [NBP3-33186] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using BRMS1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: BRMS1 Antibody (5Y8J3) [NBP3-33186] - Immunohistochemistry analysis of paraffin-embedded Rat liver using BRMS1 Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: BRMS1 Antibody (5Y8J3) [NBP3-33186] - Western blot analysis of lysates from A549 cells, using BRMS1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 5Y8J3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

BRMS1 Antibody (5Y8J3) Summary

• Description: Novus Biologicals Rabbit BRMS1 Antibody (5Y8J3) (NBP3-33186) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BRMS1 (Q9HCU9).
  
  Sequence:
  MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPE
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: BRMS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BRMS1 Antibody (5Y8J3)

• breast cancer metastasis suppressor 1
• breast cancer metastasis-suppressor 1
• DKFZP564A063

Background

BRMS1 reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase complexes (HDAC). The protein contains two coiled-coil motifs and several imperfect leucine zipper motifs. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRMS1