Brk Antibody

Images

 
Western Blot: Brk Antibody [NBP1-89935] - Analysis in control (vector only transfected HEK293T lysate) and pTK6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Brk Antibody [NBP1-89935] - Staining of human testis shows strong nuclear positivity in primary spermatocytes of seminiferous ducts..

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Brk Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTK6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Brk Protein (NBP1-89935PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Brk Antibody

  • Breast tumor kinase
  • Brk
  • BRKprotein-tyrosine kinase 6
  • EC 2.7.10
  • EC 2.7.10.2
  • FLJ42088
  • protein-tyrosine kinase BRK
  • PTK6 protein tyrosine kinase 6
  • PTK6
  • Sik
  • Tksk
  • Tyrosine-protein kinase BRK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-987
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
46780002
Species: Hu
Applications: ELISA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2848
Species: Hu, Mu
Applications: WB, ICC
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89935
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Brk Antibody (NBP1-89935) (0)

There are no publications for Brk Antibody (NBP1-89935).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Brk Antibody (NBP1-89935) (0)

There are no reviews for Brk Antibody (NBP1-89935). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Brk Antibody (NBP1-89935) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Brk Products

Bioinformatics Tool for Brk Antibody (NBP1-89935)

Discover related pathways, diseases and genes to Brk Antibody (NBP1-89935). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Brk Antibody (NBP1-89935)

Discover more about diseases related to Brk Antibody (NBP1-89935).
 

Pathways for Brk Antibody (NBP1-89935)

View related products by pathway.

PTMs for Brk Antibody (NBP1-89935)

Learn more about PTMs related to Brk Antibody (NBP1-89935).
 

Research Areas for Brk Antibody (NBP1-89935)

Find related products by research area.

Blogs on Brk

There are no specific blogs for Brk, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Brk Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTK6
Entrez