Breast cancer suppressor candidate 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Breast cancer suppressor candidate 1 Antibody [NBP1-89997] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: Breast cancer suppressor candidate 1 Antibody [NBP1-89997] - Staining of human heart muscle shows strong nuclear membrane positivity in myocytes.
Immunocytochemistry/ Immunofluorescence: Breast cancer suppressor candidate 1 Antibody [NBP1-89997] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Breast cancer suppressor candidate 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GENHLVQLIYHQNANGSWDLNEDLAKILGMSLEEIMAAQPAELVDSSGWATILAVIWLHSNGKDLKCEWELLERKAVAWMRAHAGSTMPSVVKAAIT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VWA5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Breast cancer suppressor candidate 1 Protein (NBP1-89997PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Breast cancer suppressor candidate 1 Antibody

  • BCSC-1Loss of heterozygosity 11 chromosomal region 2 gene A protein
  • BCSC1ortholog of mouse AW551984
  • Breast cancer suppressor candidate 1
  • LOH11CR2Avon Willebrand factor A domain-containing protein 5A
  • loss of heterozygosity, 11, chromosomal region 2, gene A
  • von Willebrand factor A domain containing 5A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-48993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02434
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
AF3155
Species: Mu
Applications: WB, IHC
AF2864
Species: Hu
Applications: WB, ICC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-02902
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-46429
Species: Hu
Applications: WB, IHC, IF
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB110-58778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-89997
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Breast cancer suppressor candidate 1 Antibody (NBP1-89997) (0)

There are no publications for Breast cancer suppressor candidate 1 Antibody (NBP1-89997).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Breast cancer suppressor candidate 1 Antibody (NBP1-89997) (0)

There are no reviews for Breast cancer suppressor candidate 1 Antibody (NBP1-89997). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Breast cancer suppressor candidate 1 Antibody (NBP1-89997) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Breast cancer suppressor candidate 1 Products

Bioinformatics Tool for Breast cancer suppressor candidate 1 Antibody (NBP1-89997)

Discover related pathways, diseases and genes to Breast cancer suppressor candidate 1 Antibody (NBP1-89997). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Breast cancer suppressor candidate 1 Antibody (NBP1-89997)

Discover more about diseases related to Breast cancer suppressor candidate 1 Antibody (NBP1-89997).
 

Pathways for Breast cancer suppressor candidate 1 Antibody (NBP1-89997)

View related products by pathway.

PTMs for Breast cancer suppressor candidate 1 Antibody (NBP1-89997)

Learn more about PTMs related to Breast cancer suppressor candidate 1 Antibody (NBP1-89997).

Blogs on Breast cancer suppressor candidate 1

There are no specific blogs for Breast cancer suppressor candidate 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Breast cancer suppressor candidate 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VWA5A