CEP57 Antibody

Images

 
Western Blot: CEP57 Antibody [NBP1-83045] - Analysis in human cell line MOLT-4.
Immunocytochemistry/ Immunofluorescence: CEP57 Antibody [NBP1-83045] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
Immunohistochemistry-Paraffin: CEP57 Antibody [NBP1-83045] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP57 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP57
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CEP57 Protein (NBP1-83045PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP57 Antibody

  • centrosomal protein 57kDa
  • Cep57
  • FGF2-interacting protein
  • KIAA0092centrosomal protein of 57 kDa
  • PIG8
  • Testis-specific protein 57
  • Translokin
  • TSP57proliferation-inducing protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
232-FA/CF
Species: Hu
NBP2-48993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-02898
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-15087
Species: Hu, Mu
Applications: WB
NBP1-46837
Species: Hu, Mu
Applications: WB, IP

Publications for CEP57 Antibody (NBP1-83045) (0)

There are no publications for CEP57 Antibody (NBP1-83045).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP57 Antibody (NBP1-83045) (0)

There are no reviews for CEP57 Antibody (NBP1-83045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CEP57 Antibody (NBP1-83045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEP57 Products

Bioinformatics Tool for CEP57 Antibody (NBP1-83045)

Discover related pathways, diseases and genes to CEP57 Antibody (NBP1-83045). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP57 Antibody (NBP1-83045)

Discover more about diseases related to CEP57 Antibody (NBP1-83045).
 

Pathways for CEP57 Antibody (NBP1-83045)

View related products by pathway.

PTMs for CEP57 Antibody (NBP1-83045)

Learn more about PTMs related to CEP57 Antibody (NBP1-83045).

Blogs on CEP57

There are no specific blogs for CEP57, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP57 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP57