BRE Antibody

Images

 
Western Blot: BRE Antibody [NBP1-88359] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: BRE Antibody [NBP1-88359] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: BRE Antibody [NBP1-88359] - Staining of human kidney shows strong positivity in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALQNLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BRE Protein (NBP1-88359PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRE Antibody

  • brain and reproductive organ-expressed (TNFRSF1A modulator)
  • BRCA1/BRCA2-containing complex subunit 45
  • subunit 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6604
Species: Hu
Applications: WB, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38356
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
355-BM/CF
Species: Hu, Mu, Rt
NBP1-90282
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP2-56444
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for BRE Antibody (NBP1-88359) (0)

There are no publications for BRE Antibody (NBP1-88359).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRE Antibody (NBP1-88359) (0)

There are no reviews for BRE Antibody (NBP1-88359). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BRE Antibody (NBP1-88359) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRE Products

Bioinformatics Tool for BRE Antibody (NBP1-88359)

Discover related pathways, diseases and genes to BRE Antibody (NBP1-88359). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRE Antibody (NBP1-88359)

Discover more about diseases related to BRE Antibody (NBP1-88359).
 

Pathways for BRE Antibody (NBP1-88359)

View related products by pathway.

PTMs for BRE Antibody (NBP1-88359)

Learn more about PTMs related to BRE Antibody (NBP1-88359).
 

Research Areas for BRE Antibody (NBP1-88359)

Find related products by research area.

Blogs on BRE

There are no specific blogs for BRE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRE