RAP80 Antibody - BSA Free

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-UIMC1 antibody NBP1-87156 (A) shows similar protein ...read more
Western Blot: RAP80 Antibody [NBP1-87156] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - EHMT1 and EHMT2 are required for accumulation of ubiquitin conjugates and repair factors at DNA damage sites. ICC/IF analysis of U2OS cells ...read more
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human testis.
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - Staining of human cell line U-2 OS shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human colon using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human lymph node using Anti-UIMC1 antibody.
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - EHMT1 & EHMT2 are required for accumulation of ubiquitin conjugates & repair factors at DNA damage sites. (a,b) Immunofluorescence analysis of U2OS ...read more
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - NHEJ pathway inhibition rescue HR & cell survival in FA cells. (A) Representative images of pDNA-PKcs (red) & MRE11 (green) foci in nuclei (DAPI ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
 

Independent Antibodies

       

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RAP80 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UIMC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Immunomicroscopy Reported in scientific literature (PMID:33450211)
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAP80 Protein (NBP1-87156PEP)
Publications
Read Publications using
NBP1-87156 in the following applications:

  • 3 publications
  • 1 publication
  • IM
    1 publication
  • WB
    2 publications

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAP80 Antibody - BSA Free

  • BRCA1-A complex subunit RAP80
  • RAP80
  • RAP80X2HRIP110
  • receptor associated protein 80
  • Receptor-associated protein 80
  • retinoid x receptor interacting protein
  • Retinoid X receptor-interacting protein 110
  • RXRIP110
  • ubiquitin interaction motif containing 1
  • Ubiquitin interaction motif-containing protein 1
  • UIMC1
  • X2HRIP110

Background

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. TRAP80 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. TRAP80 is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed 12910245; Barry and Johnston PubMed: 9234514). The animals cells produce the protein, which stimulates the animals immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-76831
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
AF6604
Species: Hu
Applications: IHC, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, WB
AF7114
Species: Hu
Applications: WB
NBP1-32304
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, KO, WB
NB100-319
Species: Hu
Applications: IP, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP3-16793
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31883
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PLA, Simple Western, WB
AF2396
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-56444
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP3-46115
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for RAP80 Antibody (NBP1-87156)(11)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IHC-P, IM, WB.


Filter By Application
ICC/IF
(3)
IHC-P
(1)
IM
(1)
WB
(2)
All Applications
Filter By Species
Human
(8)
Mouse
(1)
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using NBP1-87156 Applications Species
Jiang Q, Foglizzo M, Morozov YI et al. Autologous K63 deubiquitylation within the BRCA1-A complex licenses DNA damage recognition The Journal of cell biology 2022-09-05 [PMID: 35938958] (WB, Mouse, Human)

Details:
Dilution used 1:1000
WB Mouse, Human
Sherker A, Chaudhary N, Adam S et al. Two redundant ubiquitin-dependent pathways of BRCA1 localization to DNA damage sites EMBO reports 2021-12-06 [PMID: 34726323]
Nakamura K, Kustatscher G, Alabert C, et al. Proteome dynamics at broken replication forks reveal a distinct ATM-directed repair response suppressing DNA double-strand break ubiquitination Molecular cell 2021-01-11 [PMID: 33450211] (ICC/IF, IM, Human) ICC/IF, IM Human
Bodo S, Campagne C, Thin TH et al. Single-dose radiotherapy disables tumor cell homologous recombination via ischemia/reperfusion injury J. Clin. Invest. 2018-11-27 [PMID: 30480549] (IHC-P, Human) IHC-P Human
Yasuhara T, Kato R, Hagiwara Y et al. Human Rad52 Promotes XPG-Mediated R-loop Processing to Initiate Transcription-Associated Homologous Recombination Repair. Cell 2018-09-18 [PMID: 30245011] (Human) Human
Watanabe S, Iimori M, Chan DV et al. MDC1 methylation mediated by lysine methyltransferases EHMT1 and EHMT2 regulates active ATM accumulation flanking DNA damage sites. Sci Rep. 2018-07-18 [PMID: 30022091] (ICC/IF, Human) ICC/IF Human
Baranes-Bachar K, Levy-Barda A, Oehler J et al. The Ubiquitin E3/E4 Ligase UBE4A Adjusts Protein Ubiquitylation and Accumulation at Sites of DNA Damage, Facilitating Double-Strand Break Repair. Mol. Cell. 2018-03-01 [PMID: 29499138] (Human) Human
Ha K, Ma C, Lin H et al. The anaphase promoting complex impacts repair choice by protecting ubiquitin signalling at DNA damage sites. Nat Commun. 2017-06-12 [PMID: 28604711] (Human) Human
Renaud E, Barascu A, Rosselli F. Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells. Nucleic Acids Res 2016-01-29 [PMID: 26446986] (WB) WB
Kato K, Nakajima K, Ui A et al. Fine-Tuning of DNA Damage-Dependent Ubiquitination by OTUB2 Supports the DNA Repair Pathway Choice. Mol. Cell 2014-02-24 [PMID: 24560272] (ICC/IF, Human) ICC/IF Human
Show All 11 Publications.

Reviews for RAP80 Antibody (NBP1-87156) (0)

There are no reviews for RAP80 Antibody (NBP1-87156). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAP80 Antibody (NBP1-87156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAP80 Products

Research Areas for RAP80 Antibody (NBP1-87156)

Find related products by research area.

Blogs on RAP80

There are no specific blogs for RAP80, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAP80 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol UIMC1
Entrez
Uniprot