RAP80 Antibody

Images

 
Western Blot: RAP80 Antibody [NBP1-87156] - Analysis in control (vector only transfected HEK293T lysate) and UIMC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - Staining of human cell line U-2 OS shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human testis.
Western Blot: RAP80 Antibody [NBP1-87156] - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human testis using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human colon using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human lymph node using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-UIMC1 antibody NBP1-87156 (A) shows similar protein distribution across tissues to ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAP80 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG
Specificity
Specificity of human RAP80 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UIMC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAP80 Protein (NBP1-87156PEP)
Publications
Read Publications using
NBP1-87156 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAP80 Antibody

  • BRCA1-A complex subunit RAP80
  • RAP80
  • RAP80X2HRIP110
  • receptor associated protein 80
  • Receptor-associated protein 80
  • retinoid x receptor interacting protein
  • Retinoid X receptor-interacting protein 110
  • RXRIP110
  • ubiquitin interaction motif containing 1
  • Ubiquitin interaction motif-containing protein 1
  • UIMC1
  • X2HRIP110

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38356
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6604
Species: Hu
Applications: WB, IHC
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, ICC, KO
H00009025-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-32304
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, KO
NB100-319
Species: Hu
Applications: WB, IP
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-56444
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00008337-P01
Species: Hu
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RAP80 Antibody (NBP1-87156)(7)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(2)
WB
(1)
All Applications
Filter By Species
Human
(5)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-87156 Applications Species
Yasuhara T, Kato R, Hagiwara Y et al. Human Rad52 Promotes XPG-Mediated R-loop Processing to Initiate Transcription-Associated Homologous Recombination Repair. Cell Sep 18 2018 [PMID: 30245011] (Human) Human
Watanabe S, Iimori M, Chan DV et al. MDC1 methylation mediated by lysine methyltransferases EHMT1 and EHMT2 regulates active ATM accumulation flanking DNA damage sites. Sci Rep. Jul 18 2018 [PMID: 30022091] (ICC/IF, Human) ICC/IF Human
Baranes-Bachar K, Levy-Barda A, Oehler J et al. The Ubiquitin E3/E4 Ligase UBE4A Adjusts Protein Ubiquitylation and Accumulation at Sites of DNA Damage, Facilitating Double-Strand Break Repair. Mol. Cell. Mar 1 2018 [PMID: 29499138] (Human) Human
Ha K, Ma C, Lin H et al. The anaphase promoting complex impacts repair choice by protecting ubiquitin signalling at DNA damage sites. Nat Commun. 2017 Jun 12 [PMID: 28604711] (Human) Human
Renaud E, Barascu A, Rosselli F. Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells. Nucleic Acids Res 2016 Jan 29 [PMID: 26446986] (WB) WB
Kato K, Nakajima K, Ui A et al. Fine-Tuning of DNA Damage-Dependent Ubiquitination by OTUB2 Supports the DNA Repair Pathway Choice. Mol. Cell 2014 Feb 24 [PMID: 24560272] (ICC/IF, Human) ICC/IF Human
Lin ZP, Ratner ES, Whicker ME et al. Triapine Disrupts CtIP-Mediated Homologous Recombination Repair and Sensitizes Ovarian Cancer Cells to PARP and Topoisomerase Inhibitors. Mol. Cancer Res. 2014 Feb 28 [PMID: 24413181]

Reviews for RAP80 Antibody (NBP1-87156) (0)

There are no reviews for RAP80 Antibody (NBP1-87156). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAP80 Antibody (NBP1-87156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RAP80 Antibody (NBP1-87156)

Discover related pathways, diseases and genes to RAP80 Antibody (NBP1-87156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAP80 Antibody (NBP1-87156)

Discover more about diseases related to RAP80 Antibody (NBP1-87156).
 

Pathways for RAP80 Antibody (NBP1-87156)

View related products by pathway.

PTMs for RAP80 Antibody (NBP1-87156)

Learn more about PTMs related to RAP80 Antibody (NBP1-87156).
 

Research Areas for RAP80 Antibody (NBP1-87156)

Find related products by research area.

Blogs on RAP80

There are no specific blogs for RAP80, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAP80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UIMC1
Entrez
Uniprot