Independent Antibodies: Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-UIMC1 antibody NBP1-87156 (A) shows similar protein ...read more
Western Blot: RAP80 Antibody [NBP1-87156] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - EHMT1 and EHMT2 are required for accumulation of ubiquitin conjugates and repair factors at DNA damage sites. ICC/IF analysis of U2OS cells ...read more
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human testis.
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - Staining of human cell line U-2 OS shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human colon using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human lymph node using Anti-UIMC1 antibody.
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - EHMT1 & EHMT2 are required for accumulation of ubiquitin conjugates & repair factors at DNA damage sites. (a,b) Immunofluorescence analysis of U2OS ...read more
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - NHEJ pathway inhibition rescue HR & cell survival in FA cells. (A) Representative images of pDNA-PKcs (red) & MRE11 (green) foci in nuclei (DAPI ...read more
Novus Biologicals Rabbit RAP80 Antibody - BSA Free (NBP1-87156) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RAP80 Antibody: Cited in 11 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UIMC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for RAP80 Antibody - BSA Free
BRCA1-A complex subunit RAP80
RAP80
RAP80X2HRIP110
receptor associated protein 80
Receptor-associated protein 80
retinoid x receptor interacting protein
Retinoid X receptor-interacting protein 110
RXRIP110
ubiquitin interaction motif containing 1
Ubiquitin interaction motif-containing protein 1
UIMC1
X2HRIP110
Background
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. TRAP80 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. TRAP80 is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed 12910245; Barry and Johnston PubMed: 9234514). The animals cells produce the protein, which stimulates the animals immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our RAP80 Antibody - BSA Free and receive a gift card or discount.