DEPDC1B Antibody - BSA Free

Western Blot: DEPDC1B Antibody [NBP2-56444] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Immunohistochemistry-Paraffin: DEPDC1B Antibody [NBP2-56444] - Immunohistochemical staining of human gallbladder shows cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DEPDC1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVKLVNSKFIIHNVYSVSKQGVVILDDKSKELPHW
• Predicted Species: Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEPDC1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DEPDC1B Recombinant Protein Antigen (NBP2-56444PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DEPDC1B Antibody - BSA Free

• BRCC3
• breast cancer cell 3
• DEP domain containing 1B
• DEP domain-containing protein 1B
• FLJ11252
• HBV XAg-transactivated protein 8
• HBV X-transactivated gene 8 protein
• HBxAg transactivated protein 1
• XTP1
• XTP8

Background

DEPDC1B( AAH10904, 1 a.a. - 188 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEPDC1B