BRCAA1 Antibody

Images

 
Immunohistochemistry: BRCAA1 Antibody [NBP1-90007] - Staining of human placenta shows moderate nuclear positivity in decidua cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRCAA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARID4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BRCAA1 Protein (NBP1-90007PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRCAA1 Antibody

  • 180 kDa Sin3-associated polypeptide
  • ARID domain-containing protein 4B
  • AT rich interactive domain 4B (RBP1- like)
  • AT rich interactive domain 4B (RBP1-like)
  • AT-rich interactive domain-containing protein 4B
  • BRCAA1DKFZp313M2420
  • breast cancer-associated antigen 1
  • Breast cancer-associated antigen BRCAA1
  • breast carcinoma-associated antigen
  • Histone deacetylase complex subunit SAP180
  • Rb-binding protein homolog
  • RBBP1L1RBP1L1BCAA
  • RBP1-like protein
  • retinoblastoma binding protein 1-like 1
  • Retinoblastoma-binding protein 1-like 1
  • SAP180MGC163290
  • SIN3A-associated protein 180
  • Sin3-associated polypeptide p180

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32652
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NBP1-90007
Species: Hu
Applications: IHC, IHC-P

Publications for BRCAA1 Antibody (NBP1-90007) (0)

There are no publications for BRCAA1 Antibody (NBP1-90007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRCAA1 Antibody (NBP1-90007) (0)

There are no reviews for BRCAA1 Antibody (NBP1-90007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BRCAA1 Antibody (NBP1-90007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRCAA1 Products

Bioinformatics Tool for BRCAA1 Antibody (NBP1-90007)

Discover related pathways, diseases and genes to BRCAA1 Antibody (NBP1-90007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRCAA1 Antibody (NBP1-90007)

Discover more about diseases related to BRCAA1 Antibody (NBP1-90007).
 

Pathways for BRCAA1 Antibody (NBP1-90007)

View related products by pathway.

PTMs for BRCAA1 Antibody (NBP1-90007)

Learn more about PTMs related to BRCAA1 Antibody (NBP1-90007).
 

Research Areas for BRCAA1 Antibody (NBP1-90007)

Find related products by research area.

Blogs on BRCAA1

There are no specific blogs for BRCAA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRCAA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID4B