BPHL Antibody - BSA Free

Western Blot: BPHL Antibody [NBP2-87079] - Host: Rabbit. Target Name: BPHL. Sample Tissue: Human Neurofibroma Tumor lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BPHL Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BPHL. Peptide sequence: FGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BPHL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BPHL Antibody - BSA Free

• biphenyl hydrolase-like (serine hydrolase)
• Biphenyl hydrolase-like protein
• Biphenyl hydrolase-related protein
• Bph-rp
• Breast epithelial mucin-associated antigen
• EC 3.1
• MCNAA
• MGC125930
• MGC41865
• VACVASE
• valacyclovir hydrolase
• valacyclovirase

Background

The serine hydrolases, including BPHL, are defined as a functional class of hydrolytic enzymes that contain a serine residue in their active site. They can be grouped into subfamilies that contain closely related members in terms of substrate specificity or amino acid sequence similarity (Puente and Lopez-Otin, 1995 [PubMed 7759552]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BPHL