BMX Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit BMX Antibody - BSA Free (NBP1-84778) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BMX |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for BMX Antibody - BSA Free
Background
The Tec family of non-receptor tyrosine kinases is composed of six proteins designated Tec, Emt (also known as Itk or Tsk), Btk (previously known as Atk, BPK or Emb), Bmx, Txk (also known as Rlk) and Dsrc28C. All members of the family contain SH3 and SH2 domains and, with the exception of Txk and Dsrc28C, also contain a pleckstrin homology (PH) and a Tec homology (TH) domain in their amino termini. Four alternatively spliced forms of Tec are found to be expressed broadly in cells of hematopoietic lineage and hepatocytes. The 72 kDa Emt gene product associates with CD28 and becomes activated subsequent to CD28 ligation. Btk is necessary for proper B cell development, and mutations in the gene encoding Btk have been associated with families suffering from X-linked agammaglobulinemia, also referred to as Bruton's disease. The 80 kDa Bmx protein shares a high degree of homology with Btk and seems to be expressed at highest levels in the heart. Txk expression is T cell-specific, while expression of the Drosophila Tec homolog, Dsrc28C, is developmentally regulated.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for BMX Antibody (NBP1-84778) (0)
There are no publications for BMX Antibody (NBP1-84778).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BMX Antibody (NBP1-84778) (0)
There are no reviews for BMX Antibody (NBP1-84778).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for BMX Antibody (NBP1-84778) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional BMX Products
Research Areas for BMX Antibody (NBP1-84778)
Find related products by research area.
|
Blogs on BMX