BMX Antibody

Images

 
Western Blot: BMX Antibody [NBP1-84778] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: BMX Antibody [NBP1-84778] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BMX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BMX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BMX Protein (NBP1-84778PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BMX Antibody

  • BMX non-receptor tyrosine kinase
  • BMX
  • Bone marrow tyrosine kinase gene in chromosome X protein
  • EC 2.7.10
  • EC 2.7.10.2
  • Epithelial and endothelial tyrosine kinase
  • ETK
  • Etk/Bmx cytosolic tyrosine kinase
  • ETKcytoplasmic tyrosine-protein kinase BMX
  • NTK38 tyrosine kinase
  • NTK38
  • PSCTK2
  • PSCTK3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-37000
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for BMX Antibody (NBP1-84778) (0)

There are no publications for BMX Antibody (NBP1-84778).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMX Antibody (NBP1-84778) (0)

There are no reviews for BMX Antibody (NBP1-84778). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMX Antibody (NBP1-84778) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMX Products

Bioinformatics Tool for BMX Antibody (NBP1-84778)

Discover related pathways, diseases and genes to BMX Antibody (NBP1-84778). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMX Antibody (NBP1-84778)

Discover more about diseases related to BMX Antibody (NBP1-84778).
 

Pathways for BMX Antibody (NBP1-84778)

View related products by pathway.

PTMs for BMX Antibody (NBP1-84778)

Learn more about PTMs related to BMX Antibody (NBP1-84778).
 

Research Areas for BMX Antibody (NBP1-84778)

Find related products by research area.

Blogs on BMX

There are no specific blogs for BMX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BMX
Entrez