BMP-9 Antibody (4D2)

Images

 
Sandwich ELISA: BMP-9 Antibody (4D2) [H00002658-M01] - Detection limit for recombinant GST tagged GDF2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BMP-9 Antibody (4D2) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
GDF2 (NP_057288, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYE
Specificity
GDF2 (4D2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GDF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BMP-9 Antibody (4D2)

  • BMP9
  • BMP-9
  • BMP9BMP-9Bone morphogenetic protein 9
  • GDF2
  • GDF-2
  • growth differentiation factor 2
  • growth/differentiation factor 2

Background

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BMP-9 Antibody (H00002658-M01) (0)

There are no publications for BMP-9 Antibody (H00002658-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-9 Antibody (H00002658-M01) (0)

There are no reviews for BMP-9 Antibody (H00002658-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BMP-9 Antibody (H00002658-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMP-9 Products

Research Areas for BMP-9 Antibody (H00002658-M01)

Find related products by research area.

Blogs on BMP-9

There are no specific blogs for BMP-9, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMP-9 Antibody (4D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF2
Entrez
OMIM
Uniprot