Biliverdin Reductase B/BLVRB Antibody

Images

 
Western Blot: BLVRB Antibody [NBP1-53068] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Biliverdin Reductase B/BLVRB Antibody Summary

Immunogen
Synthetic peptides corresponding to BLVRB(biliverdin reductase B (flavin reductase (NADPH))) The peptide sequence was selected from the middle region of BLVRB. Peptide sequence GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BLVRB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BLVRB and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Biliverdin Reductase B/BLVRB Antibody

  • biliverdin reductase B (flavin reductase (NADPH))
  • Biliverdin Reductase B
  • Biliverdin-IX beta-reductase
  • BLVRB
  • BVRB
  • BVR-B
  • EC 1.3.1.24
  • EC 1.5.1.30
  • flavin reductase (NADPH)
  • flavin reductase
  • FLR
  • FLRBVRB
  • FR
  • GHBP
  • Green heme-binding protein
  • MGC117413
  • NADPH-dependent diaphorase
  • NADPH-flavin reductase
  • SDR43U1
  • short chain dehydrogenase/reductase family 43U, member 1

Background

BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB3307
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Biliverdin Reductase B/BLVRB Antibody (NBP1-53068) (0)

There are no publications for Biliverdin Reductase B/BLVRB Antibody (NBP1-53068).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Biliverdin Reductase B/BLVRB Antibody (NBP1-53068) (0)

There are no reviews for Biliverdin Reductase B/BLVRB Antibody (NBP1-53068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Biliverdin Reductase B/BLVRB Antibody (NBP1-53068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Biliverdin Reductase B/BLVRB Products

Bioinformatics Tool for Biliverdin Reductase B/BLVRB Antibody (NBP1-53068)

Discover related pathways, diseases and genes to Biliverdin Reductase B/BLVRB Antibody (NBP1-53068). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Biliverdin Reductase B/BLVRB Antibody (NBP1-53068)

Discover more about diseases related to Biliverdin Reductase B/BLVRB Antibody (NBP1-53068).
 

Pathways for Biliverdin Reductase B/BLVRB Antibody (NBP1-53068)

View related products by pathway.

Blogs on Biliverdin Reductase B/BLVRB

There are no specific blogs for Biliverdin Reductase B/BLVRB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Biliverdin Reductase B/BLVRB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BLVRB
Entrez
Uniprot