Home » BHLHE23 » BHLHE23 Antibodies » BHLHE23 Antibody

BHLHE23 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: BHLHE23 Antibody [NBP2-82762] - WB Suggested Anti-Bhlhb4 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Brain
Western Blot: BHLHE23 Antibody [NBP2-82762] - WB Suggested Anti-Bhlhb4 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Brain

Product Details

Summary
Reactivity Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BHLHE23 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of mouse BHLHE23. Peptide sequence: MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAA The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
BHLHE23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BHLHE23 Antibody

  • bA305P22.3
  • basic helix-loop-helix family, member e23
  • BETA4
  • class B basic helix-loop-helix protein 4
  • class B, 4
  • class E basic helix-loop-helix protein 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Connexin 36/GJD2
Antibody
NBP1-59254
Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat
Immunohistochemistry-Frozen: Connexin 36/GJD2 Antibody [NBP1-59254] - IHC detection of Connexin 36/GJA9 in 50uM thick section of Mouse Brain. The tissues were pre-fixed overnight in 4% PFA, and primary antibody NBP1-59254 was used at a concentration of 1ug/mL (along with Parvalbumin antibody for double staining) with gentle shaking and overnight incubation at 4C. For the detection of NBP1-59254 primary, anti-rabbit Alexa 555 secondary was employed and images were captured using a confocal microscope at 63X resolution.
Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Pax6 Antibody
NB300-750
Western Blot: Pax6 Antibody [NB300-750] - Analysis of sheep retinal extract
Immunocytochemistry/Immunofluorescence: Pax6 Antibody [NB300-750] - ARPE-19 monolayer on glass substrate. Fixative Methanol Blocking Goat Serum. Dilution 1:100. Incubation 1h @ RT. This image was submitted via customer Review.
Western Blot: Pax6 Antibody [NB300-750] - Analysis of rat whole eye extract
(4 Reviews)
(4 Publications)
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
Fibulin 1 Antibody
NBP1-84725
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Analysis in human placenta and skeletal muscle tissues using NBP1-84725 antibody. Corresponding FBLN1 RNA-seq data are presented for the same tissues.
Western Blot: Fibulin 1 Antibody [NBP1-84725] - Analysis in human cell lines HeLa and SK-MEL-30 using Anti-FBLN1 antibody. Corresponding FBLN1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunohistochemistry-Paraffin: Fibulin 1 Antibody [NBP1-84725] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
EBF-1 Antibody
(1G8)
H00001879-M02
Western Blot: EBF-1 Antibody (1G8) [H00001879-M02] - Analysis of EBF1 expression in transfected 293T cell line by EBF1 monoclonal antibody (M02), clone 1G8.Lane 1: EBF1 transfected lysate(64 KDa).Lane 2: Non-transfected lysate.
Western Blot: EBF-1 Antibody (1G8) [H00001879-M02] - Analysis of EBF1 over-expressed 293 cell line, cotransfected with EBF1 Validated Chimera RNAi ( Cat # H00001879-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with EBF1 monoclonal antibody (M02), clone 1G8 (Cat # H00001879-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: EBF-1 Antibody (1G8) [H00001879-M02] - Detection limit for recombinant GST tagged EBF1 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IP, RNAi, S-ELISA
Kv11.1 Antibody
NBP3-03109
Western Blot: Kv11.1 Antibody [NBP3-03109] - Analysis of extracts of various cell lines, using Kv11.1 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhan
Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Paraffin-embedded human lung cancer using Kv11.1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Paraffin-embedded human breast cancer using Kv11.1 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
LIM1 Antibody
(OTI2D5)
NBP2-01926
Western Blot: LIM1 Antibody (OTI2D5) [NBP2-01926] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY LIM1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-LIM1.
Immunocytochemistry/Immunofluorescence: LIM1 Antibody (OTI2D5) [NBP2-01926] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY LIM1.
Immunohistochemistry-Paraffin: LIM1 Antibody (OTI2D5) [NBP2-01926] - Staining of paraffin-embedded Human prostate tissue using anti-LIM1 mouse monoclonal antibody.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Thioredoxin
Reductase 1/TRXR1 Ant
NBP2-20619
Western Blot: thioredoxin reductase 1 Antibody [NBP2-20619] - 50 ug Rat brain lysate/extract 7. 5% SDS-PAGE TrxR1 antibody [N3C2], Internal dilution: 1:1000.
Immunocytochemistry/Immunofluorescence: thioredoxin reductase 1 Antibody [NBP2-20619] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Thioredoxin Reductase 1/TRXR1 Antibody [NBP2-20619] - TrxR1 antibody [N3C2], Internal detects TrxR1 protein at cytoplasm and nucleus in mouse liver by Immunohistochemical analysis. Sample: Paraffin-embedded mouse liver. TrxR1 antibody [N3C2], Internal diluted at 1:500.
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
RABL2A Antibody
(OTI4A8) - Azide and ...
NBP2-73776
Western Blot: RABL2A Antibody (OTI4A8) - Azide and BSA Free [NBP2-73776] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RABL2A (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RABL2A.
Immunocytochemistry/Immunofluorescence: RABL2A Antibody (OTI4A8) - Azide and BSA Free [NBP2-73776] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY RABL2A.
Flow Cytometry: RABL2A Antibody (OTI4A8) - Azide and BSA Free [NBP2-73776] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-RABL2A antibody, and then analyzed by flow cytometry.
Species: Hu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, CyTOF-ready
TAL2 Antibody
NBP1-88638
Immunocytochemistry/Immunofluorescence: TAL2 Antibody [NBP1-88638] - Staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: TAL2 Antibody [NBP1-88638] - Staining of human kidney shows cytoplasmic positivity in renal tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZBED4 Antibody
NBP2-13531
Western Blot: ZBED4 Antibody [NBP2-13531] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: ZBED4 Antibody [NBP2-13531] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: ZBED4 Antibody [NBP2-13531] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ID2 Antibody
NBP2-27194
Western Blot: ID2 Antibody [NBP2-27194] - Analysis using ID2 antibody. Lysate from human brain in the 1) absence and 2) presence of immunizing peptide, 3) mouse and 4) rat brain probed with ID2 antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: ID2 Antibody [NBP2-27194] - IF Confocal analysis of A549 cells using ID2 antibody (NBP2-27194, 1:5). An Alexa Fluor 488-conjugated Goat to rabbit IgG was used as secondary antibody (green). Actin filaments were labeled with Alexa Fluor 568 phalloidin (red). DAPI was used to stain the cell nuclei (blue). Image from verified customer review.
(1 Review)
(1 Publication)
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
MIST1 Antibody
(6E8/A12/C11P1)
NBP2-22478
Immunohistochemistry: MIST1 Antibody (6E8/A12/C11P1) [NBP2-22478] - Mist1 expression can be observed in mouse gastric chief cells(red). image is courtesy of customer review.
Immunohistochemistry-Paraffin: MIST1 Antibody (6E8/A12/C11P1) [NBP2-22478] - Staining of mouse pancreas tissues. The antibody gives nuclear staining in acinar cells but not in duct or islet cells.
(1 Review)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
ERG Antibody
NBP2-60655
Western Blot: ERG Antibody [NBP2-60655] - Total protein from Human THP-1, Jurkat and K562 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-ERG in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: ERG Antibody [NBP2-60655] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-ERG at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: ERG Antibody [NBP2-60655] - IHC analysis of a formalin fixed paraffin embedded tissue section of the human kidney (NBP1-78269) using 1:100 dilution of ERG antibody. The signal was developed using HRP-DAB method which followed counterstaining of the cells with hematoxylin. The antibody generated mainly a nuclear staining with weak cytoplasmic positivity in the cells of the glomeruli and the tubular epithelial cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TCF7L2 Antibody
(3A4)
H00006934-M06
Western Blot: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of TCF7L2 expression in K-562 (Cat # L009V1).
Immunocytochemistry/Immunofluorescence: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
GAP-43 Antibody
NB300-143
Immunohistochemistry-Paraffin: GAP-43 Antibody [NB300-143] - Review image from confirmed customer on mouse E15.5 paraffin sections.
Western Blot: GAP-43 Antibody [NB300-143] - Different tissue and cell lysates using rabbit pAb to GAP43, dilution 1:20,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] SH-SY5Y cells, [7] C6 cells. Single band at 43 kDa mark corresponds to GAP43 protein. The GAP43 protein is detected only in the lysates of neuronal origin. C6 cells are a rat glioma cell line and do not express GAP43 protein
Immunohistochemistry: GAP-43 Antibody [NB300-143] - Representative images of immunohistological staining (brown) of OMP-positive (OMP+) cells, GAP43+ immature ORNs. Tissue sections were counterstained with the nuclear dye hematoxylin (blue). Numbers of SOX2+ ORN progenitors and Ki67+ actively proliferating cells per mm of the basal layer and OMP+ mature ORNs, GAP43+ immature ORNs, and Cas3+ apoptotic cells per mm of the OE in saline or rhIGF-1-treated mice. Open circles, rectangles, and triangles represent the values for each mouse in the saline, low-IGF-1, and high-IGF-1 treated groups (each n = 6), respectively. Image collected and cropped by Cite Ab from the following publication (Dose-Dependent Effects of Insulin-Like Growth Factor 1 in the Aged Olfactory Epithelium. Front Aging Neurosci (2018)) licensed under a CC-BY licence.
(1 Review)
(74 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Eq, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Aquaporin-0
Antibody
NBP2-92773
Western Blot: Aquaporin-0 Antibody [NBP2-92773] - Analysis of extracts of various cell lines, using Aquaporin-0 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Paraffin-embedded rat brain using Aquaporin-0.
Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Paraffin-embedded human stomach using Aquaporin-0.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

PMM1/Phosphomannomutas
NBP1-87055
Western Blot: PMM1/Phosphomannomutase 1 Antibody [NBP1-87055] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PMM1/Phosphomannomutase 1 Antibody [NBP1-87055] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.
Western Blot: PMM1/Phosphomannomutase 1 Antibody [NBP1-87055] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Islet-1 Antibody
[Unconjugated]
AF1837
Islet-1 Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu
Applications: WB, Simple Western, ICC
TSHZ2 Antibody
NBP1-88303
Immunocytochemistry/Immunofluorescence: TSHZ2 Antibody [NBP1-88303] - Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TSHZ2 Antibody [NBP1-88303] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunocytochemistry/Immunofluorescence: TSHZ2 Antibody [NBP1-88303] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli, plasma membrane and golgi apparatus.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
BHLHE23 Antibody
NBP2-82762
BHLHE23 Antibody
Species: Mu, Rt
Applications: WB

Publications for BHLHE23 Antibody (NBP2-82762) (0)

There are no publications for BHLHE23 Antibody (NBP2-82762).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BHLHE23 Antibody (NBP2-82762) (0)

There are no reviews for BHLHE23 Antibody (NBP2-82762). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BHLHE23 Antibody (NBP2-82762) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional BHLHE23 Products

Bioinformatics Tool for BHLHE23 Antibody (NBP2-82762)

Discover related pathways, diseases and genes to BHLHE23 Antibody (NBP2-82762). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BHLHE23

There are no specific blogs for BHLHE23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BHLHE23 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol BHLHE23