BHLHE23 Antibody

Images

 
Western Blot: BHLHE23 Antibody [NBP2-82762] - WB Suggested Anti-Bhlhb4 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Brain

Product Details

Summary
Reactivity Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BHLHE23 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of mouse BHLHE23. Peptide sequence: MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAA The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
BHLHE23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BHLHE23 Antibody

  • bA305P22.3
  • basic helix-loop-helix family, member e23
  • BETA4
  • class B basic helix-loop-helix protein 4
  • class B, 4
  • class E basic helix-loop-helix protein 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
H00001879-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IP, RNAi, S-ELISA
NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01926
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-73776
Species: Hu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, CyTOF-ready
NBP1-88638
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13531
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-22478
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Eq, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-92773
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87055
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-88303
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-82762
Species: Mu, Rt
Applications: WB

Publications for BHLHE23 Antibody (NBP2-82762) (0)

There are no publications for BHLHE23 Antibody (NBP2-82762).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BHLHE23 Antibody (NBP2-82762) (0)

There are no reviews for BHLHE23 Antibody (NBP2-82762). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BHLHE23 Antibody (NBP2-82762) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BHLHE23 Products

Bioinformatics Tool for BHLHE23 Antibody (NBP2-82762)

Discover related pathways, diseases and genes to BHLHE23 Antibody (NBP2-82762). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BHLHE23

There are no specific blogs for BHLHE23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BHLHE23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BHLHE23