delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free

Western Blot: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Western Blot detection against Immunogen (34.1 KDa) .

Immunocytochemistry/Immunofluorescence: delta Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Mouse Skeletal Muscle stained by verified customer.

ELISA: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Detection limit for recombinant GST tagged SGCD is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clone: 3G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free Summary

• Immunogen: SGCD (NP_000328.2, 114 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ILNDQTKVLTQLITGPKAVEAYGKKFEVKTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFK
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SGCD
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for delta-Sarcoglycan Antibody (3G10) - Azide and BSA Free

• 35 kDa dystrophin-associated glycoprotein
• 35DAG
• 35kD dystrophin-associated glycoprotein
• CMD1L
• CMD1LSG-delta
• DAGD
• deltaSarcoglycan
• delta-Sarcoglycan
• delta-SG
• dystrophin associated glycoprotein, delta sarcoglycan
• LGMD2F
• MGC22567
• placental delta sarcoglycan
• sarcoglycan, delta (35kD dystrophin-associated glycoprotein)
• sarcoglycan, delta (35kDa dystrophin-associated glycoprotein)
• SGCD
• SGCDP
• SGD

Background

delta Sarcoglycan is encoded by this gene is one of the four known components of the sarcoglycan complex, which is a subcomplex of the dystrophin-glycoprotein complex (DGC). DGC forms a link between the F-actin cytoskeleton and the extracellular matrix. This protein is expressed most abundantly in skeletal and cardiac muscle. Mutations in this gene have been associated with autosomal recessive limb-girdle muscular dystrophy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for delta-Sarcoglycan Antibody (H00006444-M01-100ug) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IF Mouse 02/13/2014

Summary

• Application: Immunofluorescence
• Sample Tested: Mouse skeletal muscle
• Species: Mouse

Bioinformatics

• Gene Symbol: SGCD
• Entrez:
  • 6444(Human)
• OMIM:
  • 601287(Human)
• Uniprot:
  • NP_000328.2(Human)