Recombinant Human beta-Catenin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human beta-Catenin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human CTNNB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CTNNB1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human beta-Catenin Protein

  • bCatenin
  • beta 1 (88kD)
  • beta-Catenin
  • catenin (cadherin-associated protein), beta 1, 88kDa
  • catenin beta-1
  • CTNNB
  • CTNNB1
  • DKFZp686D02253
  • FLJ25606
  • FLJ37923

Background

CTNNB1 - catenin (cadherin-associated protein), beta 1, 88kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF4885
Species: Mu
Applications: WB, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37557
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00001499-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for beta-Catenin Partial Recombinant Protein (H00001499-Q01) (0)

There are no publications for beta-Catenin Partial Recombinant Protein (H00001499-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Catenin Partial Recombinant Protein (H00001499-Q01) (0)

There are no reviews for beta-Catenin Partial Recombinant Protein (H00001499-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-Catenin Partial Recombinant Protein (H00001499-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional beta-Catenin Products

Bioinformatics Tool for beta-Catenin Partial Recombinant Protein (H00001499-Q01)

Discover related pathways, diseases and genes to beta-Catenin Partial Recombinant Protein (H00001499-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Catenin Partial Recombinant Protein (H00001499-Q01)

Discover more about diseases related to beta-Catenin Partial Recombinant Protein (H00001499-Q01).
 

Pathways for beta-Catenin Partial Recombinant Protein (H00001499-Q01)

View related products by pathway.

PTMs for beta-Catenin Partial Recombinant Protein (H00001499-Q01)

Learn more about PTMs related to beta-Catenin Partial Recombinant Protein (H00001499-Q01).
 

Research Areas for beta-Catenin Partial Recombinant Protein (H00001499-Q01)

Find related products by research area.

Blogs on beta-Catenin.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Notch1 - A multifunctional transmembrane receptor
Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process...  Read full blog post.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human beta-Catenin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNNB1
Entrez