beta-Catenin Antibody (CL3689)

Images

 
Western Blot: beta-Catenin Antibody (CL3689) [NBP2-61628] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-549
Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of A-431 cells using the Anti-CTNNB1 monoclonal antibody, showing specific staining in the plasma membrane in green. ...read more
Immunohistochemistry-Paraffin: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of human skeletal muscle shows absence of immunoreactivity in muscle fibers (negative control).
Western Blot: beta-Catenin Antibody (CL3689) [NBP2-61628] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30
Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of U-251 cells using the Anti-CTNNB1 monoclonal antibody, showing specific staining in the plasma membrane in green. ...read more
Immunohistochemistry: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of human endometrium shows strong membranous immunoreactivity in glandular epithelium.
Immunohistochemistry: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of human kidney shows strong membranous positivity in renal tubules and glomerulus cells.
Immunohistochemistry: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of human duodenum shows strong membranous immunoreactivity in epithelial cells.
Immunohistochemistry: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of human cervix shows strong membranous positivity in epithelial cells.
Immunohistochemistry-Paraffin: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of human breast cancer shows membranous immunoreactivity in tumor cells.
Immunohistochemistry-Paraffin: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of human prostate cancer shows membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: beta-Catenin Antibody (CL3689) [NBP2-61628] - Staining of human renal cancer shows membranous positivity in tumor cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL3689
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

beta-Catenin Antibody (CL3689) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Epitope
TSQVLYEWEQGFSQS
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
CTNNB1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:20000 - 1:50000
  • Immunohistochemistry-Paraffin 1:20000 - 1:50000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.
Control Peptide
beta-Catenin Recombinant Protein Antigen (NBP2-61628PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for beta-Catenin Antibody (CL3689)

  • bCatenin
  • beta 1 (88kD)
  • beta-Catenin
  • catenin (cadherin-associated protein), beta 1, 88kDa
  • catenin beta-1
  • CTNNB
  • CTNNB1
  • DKFZp686D02253
  • FLJ25606
  • FLJ37923

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-67618
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-66858
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-61628
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for beta-Catenin Antibody (NBP2-61628) (0)

There are no publications for beta-Catenin Antibody (NBP2-61628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Catenin Antibody (NBP2-61628) (0)

There are no reviews for beta-Catenin Antibody (NBP2-61628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for beta-Catenin Antibody (NBP2-61628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-Catenin Products

Bioinformatics Tool for beta-Catenin Antibody (NBP2-61628)

Discover related pathways, diseases and genes to beta-Catenin Antibody (NBP2-61628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Catenin Antibody (NBP2-61628)

Discover more about diseases related to beta-Catenin Antibody (NBP2-61628).
 

Pathways for beta-Catenin Antibody (NBP2-61628)

View related products by pathway.

PTMs for beta-Catenin Antibody (NBP2-61628)

Learn more about PTMs related to beta-Catenin Antibody (NBP2-61628).
 

Research Areas for beta-Catenin Antibody (NBP2-61628)

Find related products by research area.

Blogs on beta-Catenin.


  Read full blog post.

Stemness is responsible for onset and metastasis of colorectal cancer
By Jamshed Arslan, Pharm. D., PhD. Colorectal cancer stem cells are a rare subpopulation of colorectal cancer cells that can self-renew and initiate and sustain tumor growth when transplanted into an animal host.1,2 C...  Read full blog post.

The role of Wnts in neuroinflammation
By Michalina Hanzel, PhDThe multifaceted roles of the Wnt family of glycoproteins have been extensively characterized throughout embryonic development and adult homeostasis. The highly conserved, cell- and tissue- s...  Read full blog post.

Stemness for Surviving Hypoxia: TGF-beta/Smad Signaling in Multiple Myeloma
By Jamshed Arslan Pharm.D. Multiple myeloma (MM) is a cancer of antibody-producing plasma cells. The bone marrow (BM) of MM patients is hypoxic, and MM cells overexpress many cancerous genes that are regulated by hy...  Read full blog post.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Notch1 - A multifunctional transmembrane receptor
Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-Catenin Antibody (CL3689) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNNB1