beta-Catenin Antibody (1C9)

Images

 
Western Blot: beta-Catenin Antibody (1C9) [H00001499-M02] - Analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody (M02), clone 1C9.Lane 1: CTNNB1 transfected lysate(85.5 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody (1C9) [H00001499-M02] - PC-3 MM2 cells were stained with CTNNB1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI ...read more
Western Blot: beta-Catenin Antibody (1C9) [H00001499-M02] - Analysis of CTNNB1 over-expressed 293 cell line, cotransfected with CTNNB1 Validated Chimera RNAi ( Cat # H00001499-R01V ) (Lane 2) or non-transfected control ...read more
Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody (1C9) [H00001499-M02] - Analysis of monoclonal antibody to CTNNB1 on HeLa cell. Antibody concentration 10 ug/ml.
Proximity Ligation Assay: beta-Catenin Antibody (1C9) [H00001499-M02] - Analysis of protein-protein interactions between GSK3B and CTNNB1. HeLa cells were stained with anti-GSK3B rabbit purified polyclonal 1:1200 and ...read more
Proximity Ligation Assay: beta-Catenin Antibody (1C9) [H00001499-M02] - Analysis of protein-protein interactions between FLT1 and CTNNB1. Huh7 cells were stained with anti-FLT1 rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: beta-Catenin Antibody (1C9) [H00001499-M02] - Detection limit for recombinant GST tagged CTNNB1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA, RNAi
Clone
1C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

beta-Catenin Antibody (1C9) Summary

Immunogen
CTNNB1 (AAH58926 682 a.a. - 781 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Marker
Epithelial Cell Marker, Adherens Junction Marker
Specificity
CTNNB1 (1C9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTNNB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
  • RNA Inhibition
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA and RNAi Validation.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for beta-Catenin Antibody (1C9)

  • bCatenin
  • beta 1 (88kD)
  • beta-Catenin
  • catenin (cadherin-associated protein), beta 1, 88kDa
  • catenin beta-1
  • CTNNB
  • CTNNB1
  • DKFZp686D02253
  • FLJ25606
  • FLJ37923

Background

Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF4885
Species: Mu
Applications: WB, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37557
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00001499-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA, RNAi

Publications for beta-Catenin Antibody (H00001499-M02) (0)

There are no publications for beta-Catenin Antibody (H00001499-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Catenin Antibody (H00001499-M02) (0)

There are no reviews for beta-Catenin Antibody (H00001499-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for beta-Catenin Antibody (H00001499-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-Catenin Products

Bioinformatics Tool for beta-Catenin Antibody (H00001499-M02)

Discover related pathways, diseases and genes to beta-Catenin Antibody (H00001499-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Catenin Antibody (H00001499-M02)

Discover more about diseases related to beta-Catenin Antibody (H00001499-M02).
 

Pathways for beta-Catenin Antibody (H00001499-M02)

View related products by pathway.

PTMs for beta-Catenin Antibody (H00001499-M02)

Learn more about PTMs related to beta-Catenin Antibody (H00001499-M02).
 

Research Areas for beta-Catenin Antibody (H00001499-M02)

Find related products by research area.

Blogs on beta-Catenin.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Notch1 - A multifunctional transmembrane receptor
Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-Catenin Antibody (1C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNNB1
Entrez
OMIM
Uniprot