beta-3 Adrenergic R/ADRB3 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse beta-3 Adrenergic R/ADRB3 (NP_038490.2). Peptide sequence RSPDFRDAFRRLLCSYGGRGPEEPRAVTFPASPVEARQSPPLNRFDGYEG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ADRB3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for beta-3 Adrenergic R/ADRB3 Antibody - BSA Free
Background
The Beta-3 Adrenoceptor (ADRB3) is an Adrenergic Receptor that stimulates lipolysis and increases fatty acids in the blood. Stimulation of the beta-3 adrenoceptor leads to lipolysis in white adipocytes and nonshivering thermogenesis in brown fat. The beta-3 adrenoceptor has also been suggested to affect the physiological control of cardiac and vascular contractility; beta-3 adrenoceptor stimulation decreases cardiac contractility through activation of a nitric oxide synthase pathway. A variant of the beta-3 adrenoceptor, Trp64Arg, has been shown to be associated with weight gain (obesity) and susceptibility to non-insulin-dependent diabetes mellitus (NIDDM), but not with coronary artery disease. Trp64Arg variant receptor has been shown to predict a greater tendency to develop abdominal adiposity and high blood pressure with advancing age. ADRB3 has been suggested to be responsible for the negative inotropic effects of catecholamines and may be involved in pathophysiological mechanisms leading to heart failure; ADRB3 is also one of the molecular targets under active research in the treatment of obeisity. Beta-3 adrenoceptor expression has been documented in adipose, heart, and in smooth muscle of digestive and urinary tract organs (bladder, colon, small intestine, stomach, ureter). Utilization of alternate promoters and/or 3-prime untranslated regions may result in tissue-specific regulation of the expression of ADRB3. ESTs have been isolated from heart/melanocyte/uterus and placenta libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, In vitro, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for beta-3 Adrenergic R/ADRB3 Antibody (NBP3-10867) (0)
There are no publications for beta-3 Adrenergic R/ADRB3 Antibody (NBP3-10867).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for beta-3 Adrenergic R/ADRB3 Antibody (NBP3-10867) (0)
There are no reviews for beta-3 Adrenergic R/ADRB3 Antibody (NBP3-10867).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for beta-3 Adrenergic R/ADRB3 Antibody (NBP3-10867) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional beta-3 Adrenergic R/ADRB3 Products
Research Areas for beta-3 Adrenergic R/ADRB3 Antibody (NBP3-10867)
Find related products by research area.
|
Blogs on beta-3 Adrenergic R/ADRB3