BCL2L10 Antibody - BSA Free

Immunohistochemistry: BCL2L10 Antibody [NBP1-88681] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BCL2L10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BCL2L10 Antibody - BSA Free (NBP1-88681) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MVDQLRERTTMADPLRERTELLLADYLGYCARE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCL2L10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BCL2L10 Protein (NBP1-88681PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BCL2L10 Antibody - BSA Free

• Apoptosis regulator Bcl-B
• apoptotic protein NrH
• BCL2L10
• Bcl2-L-10
• BCL2-like 10 (apoptosis facilitator)
• bcl-2-like protein 10
• BCLB
• BCL-B
• BOO
• DIVA
• MGC129810
• MGC129811

Background

The protein encoded by the BCL2L10 gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL2L10