BATF Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BATF Antibody [NBP2-49431] - Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BATF Antibody [NBP2-49431] - Staining of human appendix shows cytoplasmic positivity in leukocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BATF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHV
Specificity
Specificity of human BATF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BATF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BATF Antibody

  • basic leucine zipper transcription factor, ATF-like
  • BATF
  • BATF1basic leucine zipper transcriptional factor ATF-like
  • B-ATFSFA2
  • B-cell-activating transcription factor
  • SFA2
  • SFA-2activating transcription factor B
  • SF-HT-activated gene 2 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-82814
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)

Publications for BATF Antibody (NBP2-49431) (0)

There are no publications for BATF Antibody (NBP2-49431).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BATF Antibody (NBP2-49431) (0)

There are no reviews for BATF Antibody (NBP2-49431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BATF Antibody (NBP2-49431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BATF Products

Bioinformatics Tool for BATF Antibody (NBP2-49431)

Discover related pathways, diseases and genes to BATF Antibody (NBP2-49431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BATF Antibody (NBP2-49431)

Discover more about diseases related to BATF Antibody (NBP2-49431).
 

Pathways for BATF Antibody (NBP2-49431)

View related products by pathway.

PTMs for BATF Antibody (NBP2-49431)

Learn more about PTMs related to BATF Antibody (NBP2-49431).

Blogs on BATF

There are no specific blogs for BATF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BATF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BATF