BarX2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BarX2 Antibody [NBP2-57843] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BarX2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BarX2 Antibody - BSA Free (NBP2-57843) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPPQELPIPSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BARX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BarX2 Recombinant Protein Antigen (NBP2-57843PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BarX2 Antibody - BSA Free

• BarH-like homeobox 2
• BARX homeobox 2
• homeobox protein BarH-like 2
• MGC133368
• MGC133369

Background

BARX2 is a member of the Bar class of homeodomain transcription factors. It binds optimally to the DNA consensus sequence YYTAATGRTTTTY. It may control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous system. It may be involved in controlling adhesive processes in keratinizing epithelia. It is highly expressed in adult salivary gland and at much lower levels in mammary gland, kidney and placenta. It contains 1 homeobox DNA-binding domain. BarX2 is a tumour suppressor gene that encodes for a transcription factor known to regulate transcription of cell adhesion molecules in the mouse.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BARX2