BAMBI/NMA Recombinant Protein Antigen

Images

 
There are currently no images for BAMBI/NMA Protein (NBP1-82551PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BAMBI/NMA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAMBI.

Source: E.coli

Amino Acid Sequence: NKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BAMBI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82551.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BAMBI/NMA Recombinant Protein Antigen

  • BAMBI
  • BMP and activin membrane-bound inhibitor homolog (Xenopus laevis)
  • BMP and activin membrane-bound inhibitor homolog
  • NMA
  • NMANon-metastatic gene A protein
  • Putative transmembrane protein NMA

Background

BAMBI encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
314-BP/CF
Species: Hu
Applications: BA, BA
210-TA
Species: Hu
Applications: BA
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
354-BP/CF
Species: Hu
Applications: BA
DFN00
Species: Hu
Applications: ELISA
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
285-IF
Species: Hu
Applications: BA
201-LB/CF
Species: Hu
Applications: BA
AF3025
Species: Hu
Applications: ELISA, ICC, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
5190-GR
Species: Hu
Applications: BA
7754-BH/CF
Species: Hu
Applications: BA
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
D6050
Species: Hu
Applications: ELISA
758-CN/CF
Species: Mu
Applications: BA

Publications for BAMBI/NMA Protein (NBP1-82551PEP) (0)

There are no publications for BAMBI/NMA Protein (NBP1-82551PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAMBI/NMA Protein (NBP1-82551PEP) (0)

There are no reviews for BAMBI/NMA Protein (NBP1-82551PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BAMBI/NMA Protein (NBP1-82551PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAMBI/NMA Products

Bioinformatics Tool for BAMBI/NMA Protein (NBP1-82551PEP)

Discover related pathways, diseases and genes to BAMBI/NMA Protein (NBP1-82551PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAMBI/NMA Protein (NBP1-82551PEP)

Discover more about diseases related to BAMBI/NMA Protein (NBP1-82551PEP).
 

Pathways for BAMBI/NMA Protein (NBP1-82551PEP)

View related products by pathway.

PTMs for BAMBI/NMA Protein (NBP1-82551PEP)

Learn more about PTMs related to BAMBI/NMA Protein (NBP1-82551PEP).

Blogs on BAMBI/NMA

There are no specific blogs for BAMBI/NMA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BAMBI/NMA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BAMBI