Home » BAMBI/NMA » BAMBI/NMA Proteins » BAMBI/NMA Recombinant Protein Antigen

BAMBI/NMA Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BAMBI/NMA Protein (NBP1-82551PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

BAMBI/NMA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAMBI.

Source: E.coli

Amino Acid Sequence: NKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BAMBI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82551.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BAMBI/NMA Recombinant Protein Antigen

  • BAMBI
  • BMP and activin membrane-bound inhibitor homolog (Xenopus laevis)
  • BMP and activin membrane-bound inhibitor homolog
  • NMA
  • NMANon-metastatic gene A protein
  • Putative transmembrane protein NMA

Background

BAMBI encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

iNOS Antibody -
BSA Free
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Western Blot: iNOS Antibody [NB300-605] - LCA-induced oxidative stress in 4T1 breast cancer cells. The 4T1 cells were treated with LCA for 48 h, then the indicated measurements were performed. The level of iNOS protein was detected by western blotting (n = 3). Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2072-6694/11/9/1255), licensed under a CC-BY licence.
Western Blot: iNOS Antibody [NB300-605] - iNOS in stimulated astrocytes. Western blot image submitted by a verified customer review.
(3 Reviews)
(90 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
BMP-4
[Unconjugated]
314-BP/CF
1 ug/lane of Recombinant Human BMP-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 22-25 kDa and 37-41 kDa, respectively. Multiple bands in gel are due to variable glycosylation. 
Recombinant Human BMP-4 (Catalog #314-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 2.5-15 ng/mL.
(459 Publications)
Species: Hu
Applications: BA, BA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(738 Publications)
Species: Hu
Applications: BA
ISYNA1 Antibody
NBP2-47415
Immunocytochemistry/Immunofluorescence: ISYNA1 Antibody [NBP2-47415] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human testis shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
BMP-7
[Unconjugated]
354-BP/CF
Recombinant human BMP-7 (354-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 0.1-0.6 µg/mL.
(91 Publications)
Species: Hu
Applications: BA
Follistatin [HRP]
DFN00
(32 Publications)
Species: Hu
Applications: ELISA
BMP-2
[Unconjugated]
355-BM/CF
Recombinant human/mouse/rat BMP-2 (355-BM/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 40-200 ng/mL.
(179 Publications)
Species: Hu, Mu, Rt
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(2 Reviews)
(413 Publications)
Species: Hu
Applications: BA
IL-1 beta/IL-1F2
[Unconjugated]
201-LB/CF
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB/CF) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(521 Publications)
Species: Hu
Applications: BA
TGF-beta RI/ALK-5
Antibody [Unconjugate ...
AF3025
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, and Raji human Burkitt's lymphoma cell line. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human TGF‑ beta  RI/ALK‑5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3025) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Specific bands were detected for TGF‑ beta  RI/ALK‑5 at approximately 50 & 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TGF-beta  RI/ALK‑5 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) stimulated with LPS and monensin using Goat Anti-Human TGF‑ beta  RI/ALK‑5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3025) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(8 Publications)
Species: Hu
Applications: ELISA, ICC, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Immunofluorescent staining of TMAs. Representative tissue cores from normal (I), adenomatous polyps (II), and CRC (III and IV) are shown. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
(5 Reviews)
(122 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
Gremlin 1
[Unconjugated]
5190-GR
1 µg/lane of Recombinant Human Gremlin was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing major bands at 25‑30 kDa. Multiple bands in gel are due to variable glycosylation.
Recombinant Human Gremlin (Catalog # 5190‑GR) inhibits BMP-4-induced alkaline phosphatase production in the MC3T3-E1 mouse preosteoblast cell line. The ED50 for this effect is 0.025‑0.15 µg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4 (Catalog # 314‑BP).
(17 Publications)
Species: Hu
Applications: BA
TGF-beta 1
[Unconjugated]
7754-BH/CF
Recombinant human TGF-beta 1 (7754-BH/CF) inhibits recombinant mouse IL-4 induced proliferation in the HT-2 mouse T cell line. The ED50 for this effect is 0.04-0.2 ng/mL.
(21 Publications)
Species: Hu
Applications: BA
nNOS Antibody
NB100-858
Immunocytochemistry/Immunofluorescence: nNOS Antibody [NB100-858] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane, cytoplasmic and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: nNOS Antibody [NB100-858] - Flow cytometric analysis of paraformaldehyde fixed Kelly cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunocytochemistry/Immunofluorescence: nNOS Antibody [NB100-858] - Wholemount preparations of the myenteric neurons in the distal colon segments following 3 (2a-2d) and 7 (4a-4d) days of repeated in vivo oxaliplatin administration compared to sham-treated animals at 3 (1a-1d) and 7 (3a-3d) days. Myenteric ganglia and neurons labeled with beta-Tubulin Tuj1 (red), nuclei labeled with DAPI (blue) (arrows) can be seen within the ganglion (1b). Smooth muscle cells (asterisks) are also labeled with DAPI (1b). Significant increase in the proportion of nNOS neurons (green) can be seen at both Days 3 and 7 after oxaliplatin treatment. Scale bar = 20 um. Image collected and cropped by CiteAb from the following publication (www.journal.frontiersin.org/article/10.3389/fnins.2013.00030/abstract) licensed under a CC-BY licence.
(1 Review)
(13 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
MID1 Antibody
NBP3-05061
Immunocytochemistry/Immunofluorescence: MID1 Antibody [NBP3-05061] - Analysis of MCF-7 cells using MID1 antibody . Blue: DAPI for nuclear staining.
Western Blot: MID1 Antibody [NBP3-05061] - analysis of extracts of HeLa cells, using MID1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.
Species: Hu, Mu
Applications: ICC/IF, WB
IL-6 [HRP]
D6050
(693 Publications)
Species: Hu
Applications: ELISA
Chordin
[Unconjugated]
758-CN/CF
Chordin [Unconjugated]
(11 Publications)
Species: Mu
Applications: BA

Publications for BAMBI/NMA Protein (NBP1-82551PEP) (0)

There are no publications for BAMBI/NMA Protein (NBP1-82551PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAMBI/NMA Protein (NBP1-82551PEP) (0)

There are no reviews for BAMBI/NMA Protein (NBP1-82551PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BAMBI/NMA Protein (NBP1-82551PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAMBI/NMA Products

Bioinformatics Tool for BAMBI/NMA Protein (NBP1-82551PEP)

Discover related pathways, diseases and genes to BAMBI/NMA Protein (NBP1-82551PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAMBI/NMA Protein (NBP1-82551PEP)

Discover more about diseases related to BAMBI/NMA Protein (NBP1-82551PEP).
 

Pathways for BAMBI/NMA Protein (NBP1-82551PEP)

View related products by pathway.

PTMs for BAMBI/NMA Protein (NBP1-82551PEP)

Learn more about PTMs related to BAMBI/NMA Protein (NBP1-82551PEP).

Blogs on BAMBI/NMA

There are no specific blogs for BAMBI/NMA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BAMBI/NMA was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human BAMBI/NMA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF921) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in tubular epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
BAMBI/NMA Antibody [Unconjugated]
AF921
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BAMBI/NMA Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BAMBI