Recombinant Human BAAT GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human BAAT Protein [H00000570-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BAAT GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 258-355 of Human BAAT

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
BAAT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BAAT GST (N-Term) Protein

  • BACAT
  • BATbile acid-CoA:amino acid N-acyltransferase
  • bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
  • bile acid Coenzyme A: amino acid N-acyltransferase (glycineN-choloyltransferase)
  • EC 2.3.1.65
  • EC 3.1.2.2
  • FLJ20300
  • Glycine N-choloyltransferase
  • Long-chain fatty-acyl-CoA hydrolase
  • MGC104432

Background

BAAT - bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-59742
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, PEP-ELISA
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-36987
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP, In vitro, Flow-IC, IHC-WhMt
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-00178
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
MAB5826
Species: Hu
Applications: WB, IHC
NBP2-19860
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for BAAT Partial Recombinant Protein (H00000570-Q01) (0)

There are no publications for BAAT Partial Recombinant Protein (H00000570-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAAT Partial Recombinant Protein (H00000570-Q01) (0)

There are no reviews for BAAT Partial Recombinant Protein (H00000570-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAAT Partial Recombinant Protein (H00000570-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional BAAT Products

Bioinformatics Tool for BAAT Partial Recombinant Protein (H00000570-Q01)

Discover related pathways, diseases and genes to BAAT Partial Recombinant Protein (H00000570-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAAT Partial Recombinant Protein (H00000570-Q01)

Discover more about diseases related to BAAT Partial Recombinant Protein (H00000570-Q01).
 

Pathways for BAAT Partial Recombinant Protein (H00000570-Q01)

View related products by pathway.

PTMs for BAAT Partial Recombinant Protein (H00000570-Q01)

Learn more about PTMs related to BAAT Partial Recombinant Protein (H00000570-Q01).

Blogs on BAAT

There are no specific blogs for BAAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BAAT GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BAAT