B9D1 Antibody

Images

 
Immunohistochemistry-Paraffin: B9D1 Antibody [NBP1-88969] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B9D1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B9D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
B9D1 Protein (NBP1-88969PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B9D1 Antibody

  • B9 domain-containing protein 1
  • B9 protein domain 1
  • B9
  • endothelial precursor protein B9
  • EPPB9
  • MKS1-related protein 1
  • MKSR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5756
Species: Hu
Applications: Flow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-88969
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for B9D1 Antibody (NBP1-88969) (0)

There are no publications for B9D1 Antibody (NBP1-88969).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B9D1 Antibody (NBP1-88969) (0)

There are no reviews for B9D1 Antibody (NBP1-88969). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for B9D1 Antibody (NBP1-88969) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B9D1 Products

Bioinformatics Tool for B9D1 Antibody (NBP1-88969)

Discover related pathways, diseases and genes to B9D1 Antibody (NBP1-88969). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B9D1 Antibody (NBP1-88969)

Discover more about diseases related to B9D1 Antibody (NBP1-88969).
 

Pathways for B9D1 Antibody (NBP1-88969)

View related products by pathway.

Blogs on B9D1

There are no specific blogs for B9D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B9D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B9D1