B7-H6 Antibody

Images

 
Western Blot: B7-H6 Antibody [NBP1-91144] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: B7-H6 Antibody [NBP1-91144] - Staining of human stomach shows weak to moderate membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: B7-H6 Antibody [NBP1-91144] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: B7-H6 Antibody [NBP1-91144] - Staining of human heart muscle shows no positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: B7-H6 Antibody [NBP1-91144] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: B7-H6 Antibody [NBP1-91144] - Staining of human breast cancer shows weak cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: B7-H6 Antibody [NBP1-91144] - Staining of human kidney shows weak membranous positivity in cells in glomeruli.
Immunohistochemistry: B7-H6 Antibody [NBP1-91144] - Staining of human prostate shows weak to moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B7-H6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFY
Specificity
Specificity of human B7-H6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCR3LG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B7-H6 Antibody

  • B7 homolog 6
  • B7H6
  • B7-H6
  • DKFZp686I21167
  • DKFZp686O24166
  • NCR3LG1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1849-NK
Species: Hu
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
MAB80841
Species: Hu
Applications: Flow, Block, CyTOF-ready, ICC
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
2249-NK
Species: Hu
AF2225
Species: Mu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBP2-75525
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
MAB342
Species: Hu
Applications: WB, AgAct
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-91144
Species: Hu
Applications: WB, IHC, IHC-P

Publications for B7-H6 Antibody (NBP1-91144) (0)

There are no publications for B7-H6 Antibody (NBP1-91144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B7-H6 Antibody (NBP1-91144) (0)

There are no reviews for B7-H6 Antibody (NBP1-91144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B7-H6 Antibody (NBP1-91144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional B7-H6 Products

Bioinformatics Tool for B7-H6 Antibody (NBP1-91144)

Discover related pathways, diseases and genes to B7-H6 Antibody (NBP1-91144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on B7-H6

There are no specific blogs for B7-H6, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B7-H6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCR3LG1
COVID-19 update