B7-H6 Antibody

Images

 
Western Blot: B7-H6 Antibody [NBP1-91144] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: B7-H6 Antibody [NBP1-91144] - Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: B7-H6 Antibody [NBP1-91144] - Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: B7-H6 Antibody [NBP1-91144] - Immunohistochemical staining of human lymph node shows strong nuclear positivity in a subset of lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B7-H6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCR3LG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
B7-H6 Protein (NBP1-91144PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B7-H6 Antibody

  • B7 homolog 6
  • B7H6
  • B7-H6
  • DKFZp686I21167
  • DKFZp686O24166
  • NCR3LG1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1849-NK
Species: Hu
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB80841
Species: Hu
Applications: Block, ICC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
2249-NK
Species: Hu
AF2225
Species: Mu
Applications: WB, Flow, AgAct, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
MAB342
Species: Hu
Applications: WB, AgAct
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow

Publications for B7-H6 Antibody (NBP1-91144) (0)

There are no publications for B7-H6 Antibody (NBP1-91144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B7-H6 Antibody (NBP1-91144) (0)

There are no reviews for B7-H6 Antibody (NBP1-91144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B7-H6 Antibody (NBP1-91144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B7-H6 Products

Bioinformatics Tool for B7-H6 Antibody (NBP1-91144)

Discover related pathways, diseases and genes to B7-H6 Antibody (NBP1-91144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on B7-H6

There are no specific blogs for B7-H6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B7-H6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCR3LG1
Entrez