Axl Antibody

Images

 
Western Blot: Axl Antibody [NBP2-38345] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate
Immunohistochemistry-Paraffin: Axl Antibody [NBP2-38345] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Axl Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSL
Specificity
Specificity of human Axl antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AXL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Axl Lysate (NBP2-65163)
Axl Lysate (NBP2-65279)
Control Peptide
Axl Protein (NBP2-38345PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Axl Antibody

  • Ark
  • AXL oncogene
  • AXL receptor tyrosine kinase
  • AXL transforming sequence/gene
  • Axl
  • EC 2.7.10
  • EC 2.7.10.1
  • JTK11
  • tyrosine-protein kinase receptor UFO
  • Ufo
  • UFOoncogene AXL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF885
Species: Hu
Applications: WB, IHC
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, Flow-IC
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-38464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Axl Antibody (NBP2-38345) (0)

There are no publications for Axl Antibody (NBP2-38345).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Axl Antibody (NBP2-38345) (0)

There are no reviews for Axl Antibody (NBP2-38345). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Axl Antibody (NBP2-38345) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Axl Antibody (NBP2-38345)

Discover related pathways, diseases and genes to Axl Antibody (NBP2-38345). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Axl Antibody (NBP2-38345)

Discover more about diseases related to Axl Antibody (NBP2-38345).
 

Pathways for Axl Antibody (NBP2-38345)

View related products by pathway.

PTMs for Axl Antibody (NBP2-38345)

Learn more about PTMs related to Axl Antibody (NBP2-38345).
 

Research Areas for Axl Antibody (NBP2-38345)

Find related products by research area.

Blogs on Axl

There are no specific blogs for Axl, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Axl Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AXL
Entrez
Uniprot