ATP6V1B2 Antibody

Images

 
Orthogonal Strategies: Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Analysis in human cell lines SK-MEL-30 and MCF-7 using anti-ATP6V1B2 antibody. Corresponding ATP6V1B2 RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: ATP6V1B2 Antibody [NBP1-88890] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining in human cerebral cortex and skeletal muscle tissues using anti-ATP6V1B2 antibody. Corresponding ATP6V1B2 RNA-seq ...read more
Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Western Blot: ATP6V1B2 Antibody [NBP1-88890] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ATP6V1B2 Antibody [NBP1-88890] - Staining of human cell line U-251MG shows positivity in golgi apparatus and vesicles.
Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: ATP6V1B2 Antibody [NBP1-88890] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ATP6V1B2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFE
Specificity
Specificity of human, mouse, rat ATP6V1B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V1B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP6V1B2 Protein (NBP1-88890PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V1B2 Antibody

  • 000 subunit
  • 56/58kD, isoform 2
  • ATP6B2ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta polypeptide
  • ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
  • Endomembrane proton pump 58 kDa subunit
  • H+ transporting two-sector ATPase
  • HO57ATP6B1B2
  • vacuolar H+-ATPase 56
  • Vacuolar proton pump subunit B 2
  • VATB
  • V-ATPase B2 subunit
  • V-ATPase subunit B 2
  • Vma2
  • VPP3ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2
  • V-type proton ATPase subunit B, brain isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33962
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33021
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88891
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85668
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89728
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88890
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP6V1B2 Antibody (NBP1-88890) (0)

There are no publications for ATP6V1B2 Antibody (NBP1-88890).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1B2 Antibody (NBP1-88890) (0)

There are no reviews for ATP6V1B2 Antibody (NBP1-88890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP6V1B2 Antibody (NBP1-88890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V1B2 Products

Bioinformatics Tool for ATP6V1B2 Antibody (NBP1-88890)

Discover related pathways, diseases and genes to ATP6V1B2 Antibody (NBP1-88890). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1B2 Antibody (NBP1-88890)

Discover more about diseases related to ATP6V1B2 Antibody (NBP1-88890).
 

Pathways for ATP6V1B2 Antibody (NBP1-88890)

View related products by pathway.

PTMs for ATP6V1B2 Antibody (NBP1-88890)

Learn more about PTMs related to ATP6V1B2 Antibody (NBP1-88890).

Blogs on ATP6V1B2

There are no specific blogs for ATP6V1B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1B2