ATP6V1C1 Antibody

Images

 
Western Blot: ATP6V1C1 Antibody [NBP1-88891] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: ATP6V1C1 Antibody [NBP1-88891] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Western Blot: ATP6V1C1 Antibody [NBP1-88891] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V1C1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V1C1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP6V1C1 Protein (NBP1-88891PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V1C1 Antibody

  • ATP6CH+-transporting ATPase chain C, vacuolar
  • ATP6Dsubunit C of vacuolar proton-ATPase V1 domain
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
  • FLJ20057
  • H(+)-transporting two-sector ATPase, subunit C
  • vacuolar ATP synthase subunit C
  • vacuolar proton pump C subunit
  • Vacuolar proton pump subunit C 1
  • vacuolar proton pump, 42-kD subunit
  • vacuolar proton-ATPase, subunit C, VI domain
  • VATCH+ -ATPase C subunit
  • V-ATPase C subunit
  • V-ATPase subunit C 1
  • Vma5
  • V-type proton ATPase subunit C 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00028299-P01
Species: Hu
NBP2-00580
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88890
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-49059
Species: Hu
Applications: WB, IHC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
H00000533-R02
Species: Hu
NBP2-14335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-55232
Species: Hu
Applications: WB, ICC/IF
NBL1-07836
Species: Hu
NBP1-88894
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46556
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88891
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ATP6V1C1 Antibody (NBP1-88891) (0)

There are no publications for ATP6V1C1 Antibody (NBP1-88891).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1C1 Antibody (NBP1-88891) (0)

There are no reviews for ATP6V1C1 Antibody (NBP1-88891). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1C1 Antibody (NBP1-88891) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V1C1 Products

Bioinformatics Tool for ATP6V1C1 Antibody (NBP1-88891)

Discover related pathways, diseases and genes to ATP6V1C1 Antibody (NBP1-88891). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1C1 Antibody (NBP1-88891)

Discover more about diseases related to ATP6V1C1 Antibody (NBP1-88891).
 

Pathways for ATP6V1C1 Antibody (NBP1-88891)

View related products by pathway.

Blogs on ATP6V1C1

There are no specific blogs for ATP6V1C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1C1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1C1