ATP6V1B2 Antibody

Images

 
Western Blot: ATP6V1B2 Antibody [NBP1-54759] - Positive Control: Lane 1: 80 ug mouse brain extract Primary Antibody Dilution : 1:500 Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR Bioscience Secondry ...read more
Western Blot: ATP6V1B2 Antibody [NBP1-54759] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V1B2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ATP6V1B2(ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2) The peptide sequence was selected from the N terminal of ATP6V1B2. Peptide sequence VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: B, brain isoform.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V1B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ATP6V1B2 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP6V1B2 Antibody

  • 000 subunit
  • 56/58kD, isoform 2
  • ATP6B2ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta polypeptide
  • ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
  • Endomembrane proton pump 58 kDa subunit
  • H+ transporting two-sector ATPase
  • HO57ATP6B1B2
  • vacuolar H+-ATPase 56
  • Vacuolar proton pump subunit B 2
  • VATB
  • V-ATPase B2 subunit
  • V-ATPase subunit B 2
  • Vma2
  • VPP3ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2
  • V-type proton ATPase subunit B, brain isoform

Background

ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00580
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33021
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-58586
Species: Hu
Applications: WB, ICC/IF
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-85668
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-73857
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
AF1049
Species: Hu
Applications: WB, IHC
NBP2-15520
Species: Hu, Mu, Rt, Ma-Op
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54759
Species: Hu, Mu, Rt, Bv, Ca, Gp, Rb
Applications: WB

Publications for ATP6V1B2 Antibody (NBP1-54759) (0)

There are no publications for ATP6V1B2 Antibody (NBP1-54759).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1B2 Antibody (NBP1-54759) (0)

There are no reviews for ATP6V1B2 Antibody (NBP1-54759). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1B2 Antibody (NBP1-54759) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATP6V1B2 Products

Bioinformatics Tool for ATP6V1B2 Antibody (NBP1-54759)

Discover related pathways, diseases and genes to ATP6V1B2 Antibody (NBP1-54759). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1B2 Antibody (NBP1-54759)

Discover more about diseases related to ATP6V1B2 Antibody (NBP1-54759).
 

Pathways for ATP6V1B2 Antibody (NBP1-54759)

View related products by pathway.

PTMs for ATP6V1B2 Antibody (NBP1-54759)

Learn more about PTMs related to ATP6V1B2 Antibody (NBP1-54759).

Blogs on ATP6V1B2

There are no specific blogs for ATP6V1B2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1B2
Uniprot