ATP6V1A Antibody - BSA Free

Western Blot: ATP6V1A Antibody [NBP2-55164] - ATP6V1A levels in MDCK lysates probed by western blot. Rabbit anti-ATP6V1A (NBP2-55164) primary antibody was used at 1:1000 dilution overnight at 4C. Image from verified customer review.

Immunocytochemistry/Immunofluorescence: ATP6V1A Antibody [NBP2-55164] - Staining of human cell line U-2 OS shows localization to nucleus, cytosol & vesicles.

Western Blot: ATP6V1A Antibody [NBP2-55164] - Analysis using Anti-ATP6V1A antibody NBP2-55164 (A) shows similar pattern to independent antibody NBP2-55148 (B).

• Reactivity: Hu, Ca, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP6V1A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATP6V1A Recombinant Protein Antigen (NBP2-55164PEP)

Reactivity Notes

Canine reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATP6V1A Antibody - BSA Free

• 70kD, isoform 1
• ATP6A1
• ATP6V1A
• ATP6V1A1
• ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1
• ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide
• ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A
• EC 3.6.3
• EC 3.6.3.14
• EC 7.1.2.2
• H(+)-transporting two-sector ATPase, subunit A
• H+-transporting ATPase chain A, vacuolar (VA68 type)
• HO68
• VA68
• vacuolar ATP synthase catalytic subunit A, ubiquitous isoform
• Vacuolar ATPase isoform VA68
• vacuolar proton pump alpha subunit 1
• Vacuolar proton pump subunit alpha
• V-ATPase 69 kDa subunit 1
• V-ATPase 69 kDa subunit
• V-ATPase A subunit 1
• V-ATPase subunit A
• Vma1
• VPP2
• V-type proton ATPase catalytic subunit A

Background

ATP6V1A encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for ATP6V1A Antibody (NBP2-55164) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Canine.

reviewed by: Huxley Hoffman WB Canine 09/01/2022

Summary

• Application: Western Blot
• Sample Tested: MDCK canine kidney epithelial cell line
• Species: Canine
• Lot: 000011945

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: ATP6V1A