Home » ATP6V0D2 » ATP6V0D2 Antibodies » ATP6V0D2 Antibody

ATP6V0D2 Antibody

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ATP6V0D2 Antibody [NBP2-31600] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue
Western Blot: ATP6V0D2 Antibody [NBP2-31600] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue
Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human tonsil shows no positivity in germinal center and non-germinal center cells as expected.
Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human lymph node shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining in human kidney and lymph node tissues using anti-ATP6V0D2 antibody. Corresponding ATP6V0D2 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH 6) at 95C for 20 minutes. Image from verified customer ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Analysis in human kidney and pancreas tissues. Corresponding ATP6V0D2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human small intestine shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

ATP6V0D2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0D2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP6V0D2 Recombinant Protein Antigen (NBP2-31600PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-31600 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V0D2 Antibody

  • ATP6D2
  • ATP6V0
  • ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
  • FLJ38708
  • Vacuolar proton pump subunit d 2
  • V-ATPase subunit d 2
  • VMA6
  • V-type proton ATPase subunit d 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DIO2 Antibody
NBP1-00178
Flow Cytometry: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed MCF7 cells (blue line), permeabilized with 0.5%Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody
Immunocytochemistry/Immunofluorescence: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton.Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
Immunohistochemistry-Frozen: DIO2 Antibody [NBP1-00178] - IHC analysis of DIO2 in cryo-sectioned Mouse Hippocampus using NBP1-00178 at 2ug/ml. Microwaved antigen retrieval with citrate buffer pH 4.5, HRP-staining.
(7 Publications)
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
ATP6V0A1 Antibody
NBP1-89342
Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human kidney shows strong cytoplasmic postivity in cells in tubules.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
ATP6V0A4 Antibody
NBP1-89330
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A4 Antibody [NBP1-89330] - Staining in human kidney and lymph node tissues using anti-ATP6V0A4 antibody. Corresponding ATP6V0A4 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
ATP6V1B1 Antibody
(OTI1H6)
NBP2-00580
Flow Cytometry: ATP6V1B1 Antibody (1H6) [NBP2-00580] - Analysis of Hela cells, using anti-ATP6V1B1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: ATP6V1B1 Antibody (1H6) [NBP2-00580] - Analysis of Jurkat cells, using anti-ATP6V1B1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: ATP6V1B1 Antibody (1H6) [NBP2-00580] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-ATP6V1B1 antibody, and then analyzed by flow cytometry.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Flow Cytometry: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of Hela cells with hnRNP C1+C2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TCIRG1 Antibody
NBP1-89333
Immunocytochemistry/Immunofluorescence: TCIRG1 Antibody [NBP1-89333] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCIRG1 Antibody [NBP1-89333] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NFATC1/NFAT2
Antibody
NB100-56732
Western Blot: NFATC1/NFAT2 Antibody [NB100-56732] - Immortalized mouse podocytes. Image from verified customer review.
Simple Western: NFATC1/NFAT2 Antibody [NB100-56732] - Lane view shows a specific band for NFAT2 in 0.5 mg/ml of RAW lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: NFATC1/NFAT2 Antibody [NB100-56732] - Analysis of human (A)Ramos and (B) mouse RAW lysate using NFATc1 antibody at 1 ug/ml.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, Simple Western, WB
ATP6V1G3 Antibody
NBP1-88894
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V1G3 Antibody [NBP1-88894] - Analysis in human kidney and skin tissues using NBP1-88894 antibody. Corresponding ATP6V1G3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
ATP6V1C2 Antibody
(OTI8H4)
NBP2-46556
Immunohistochemistry: ATP6V1C2 Antibody (8H4) [NBP2-46556] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: ATP6V1C2 Antibody (8H4) [NBP2-46556] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: ATP6V1C2 Antibody (8H4) [NBP2-46556] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ATP6V0A2 Antibody
NBP1-59069
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - Hela tissue lysate at a concentration of 1ug/ml.
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - HeLa cells, concentration 3.3 ug/ml.
Immunohistochemistry-Paraffin: ATP6V0A2 Antibody [NBP1-59069] - overexpressed mouse sequences tissue
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RFC2 Antibody
(OTI2B2) - Azide and ...
NBP2-73857
Western Blot: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Flow Cytometry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by RFC2 antibody.
Immunohistochemistry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of Adenocarcinoma of Human endometrium tissue.
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
RFC1 Antibody
[Unconjugated]
AF6457
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line. Gels were loaded with 30 µg of whole cell lysate (WCL), 20 µg of cytoplasmic (Cyto), and 10 µg of nuclear extracts (Nuc).  PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human RFC1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6457) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for RFC1 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
gamma Sarcoglycan
Antibody
NBP1-59744
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Human Heart lysate, concentration 1.25ug/ml.
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse protein. Image from verified customer review.
Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744] - Mouse tibialis anterior frozen sections. Image from verified customer review.
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-Fr, WB
Recombinant Human
PLP2 GST (N-Term) Pro ...
H00005355-P01
SDS-Page: Recombinant Human PLP2 Protein [H00005355-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
ARHGAP4 Antibody
NBP1-88527
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human spleen shows high expression.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, IP, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CD20 Antibody
(OTI4B4)
NBP2-45454
Western Blot: CD20 Antibody (OTI4B4) [NBP2-45454] - Expression of CD20 in 5 B cell lymphoma cell lines (Raji, Ly10, Daudi, CCL-155, and Ramos). Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: MS4A1/CD20 Antibody (4B4) [NBP2-45454] - Analysis of Human tonsil tissue.
Western Blot: MS4A1/CD20 Antibody (4B4) [NBP2-45454] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MS4A1.
(2 Reviews)
(1 Publication)
Species: Ca, Hu, Pm, Mu
Applications: IHC, IHC-P, WB

Publications for ATP6V0D2 Antibody (NBP2-31600) (0)

There are no publications for ATP6V0D2 Antibody (NBP2-31600).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ATP6V0D2 Antibody (NBP2-31600) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-31600:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin ATP6V0D2 NBP2-31600
Enlarge 		5
reviewed by:
Santhosh Sivajothi
 IHC-P Human 05/22/2018
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedHuman kidney tissue
SpeciesHuman
LotR73682

Comments

CommentsHeat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V0D2 Antibody (NBP2-31600) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ATP6V0D2 Products

Bioinformatics Tool for ATP6V0D2 Antibody (NBP2-31600)

Discover related pathways, diseases and genes to ATP6V0D2 Antibody (NBP2-31600). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0D2 Antibody (NBP2-31600)

Discover more about diseases related to ATP6V0D2 Antibody (NBP2-31600).
 

Pathways for ATP6V0D2 Antibody (NBP2-31600)

View related products by pathway.

PTMs for ATP6V0D2 Antibody (NBP2-31600)

Learn more about PTMs related to ATP6V0D2 Antibody (NBP2-31600).

Blogs on ATP6V0D2

There are no specific blogs for ATP6V0D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunohistochemistry-Paraffin ATP6V0D2 NBP2-31600
Enlarge
 Santhosh Sivajothi
05/22/2018
Application: IHC-P
Species: Human
read this review

Bioinformatics

Gene Symbol ATP6V0D2
Uniprot