ATP6V0D2 Antibody


Western Blot: ATP6V0D2 Antibody [NBP2-31600] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue
Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH 6) at 95C for 20 minutes. Image from verified customer more
Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human lymph node shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining in human kidney and lymph node tissues using anti-ATP6V0D2 antibody. Corresponding ATP6V0D2 RNA-seq data are more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

ATP6V0D2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG
Specificity of human ATP6V0D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP6V0D2 Protein (NBP2-31600PEP)
Reviewed Applications
Read 1 Review rated 5
NBP2-31600 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ATP6V0D2 Antibody

  • ATP6D2
  • ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
  • FLJ38708
  • Vacuolar proton pump subunit d 2
  • V-ATPase subunit d 2
  • VMA6
  • V-type proton ATPase subunit d 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow

Publications for ATP6V0D2 Antibody (NBP2-31600) (0)

There are no publications for ATP6V0D2 Antibody (NBP2-31600).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ATP6V0D2 Antibody (NBP2-31600) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-31600:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin ATP6V0D2 NBP2-31600
reviewed by:
Santhosh Sivajothi
IHC-P Human 05/22/2018


Sample TestedHuman kidney tissue


CommentsHeat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V0D2 Antibody (NBP2-31600) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ATP6V0D2 Antibody (NBP2-31600)

Discover related pathways, diseases and genes to ATP6V0D2 Antibody (NBP2-31600). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0D2 Antibody (NBP2-31600)

Discover more about diseases related to ATP6V0D2 Antibody (NBP2-31600).

Pathways for ATP6V0D2 Antibody (NBP2-31600)

View related products by pathway.

PTMs for ATP6V0D2 Antibody (NBP2-31600)

Learn more about PTMs related to ATP6V0D2 Antibody (NBP2-31600).

Blogs on ATP6V0D2

There are no specific blogs for ATP6V0D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Santhosh Sivajothi
Application: IHC-P
Species: Human


Gene Symbol ATP6V0D2