Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG |
Specificity | Specificity of human ATP6V0D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ATP6V0D2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Reviewed Applications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Santhosh Sivajothi |
IHC-P | Human | 05/22/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for ATP6V0D2 Antibody (NBP2-31600)Discover more about diseases related to ATP6V0D2 Antibody (NBP2-31600).
| Pathways for ATP6V0D2 Antibody (NBP2-31600)View related products by pathway.
|
PTMs for ATP6V0D2 Antibody (NBP2-31600)Learn more about PTMs related to ATP6V0D2 Antibody (NBP2-31600).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.