ATP6V0D2 Antibody

Western Blot: ATP6V0D2 Antibody [NBP2-31600] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue

Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH 6) at 95C for 20 minutes. Image from verified customer review.

Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: ATP6V0D2 Antibody [NBP2-31600] - Staining in human kidney and lymph node tissues using anti-ATP6V0D2 antibody. Corresponding ATP6V0D2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ATP6V0D2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG
• Specificity: Specificity of human ATP6V0D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V0D2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ATP6V0D2 Protein (NBP2-31600PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP6V0D2 Antibody

• ATP6D2
• ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2
• ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2
• ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
• FLJ38708
• Vacuolar proton pump subunit d 2
• V-ATPase subunit d 2
• VMA6
• V-type proton ATPase subunit d 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for ATP6V0D2 Antibody (NBP2-31600) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Santhosh Sivajothi IHC-P Human 05/22/2018

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Human kidney tissue
• Species: Human
• Lot: R73682

Comments

• Comments: Heat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes

Bioinformatics

• Gene Symbol: ATP6V0D2
• Uniprot:
  • Q8N8Y2(Human)