ATP6AP1 Antibody - BSA Free

Western Blot: ATP6AP1 Antibody [NBP1-57020] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATP6AP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ATP6AP1 (ATPase, H+ transporting, lysosomal accessory protein 1) The peptide sequence was selected from the middle region of ATP6AP1. Peptide sequence SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6AP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP6AP1 Antibody - BSA Free

• 16A
• Ac45
• ATP6IP1V-ATPase subunit S1
• ATP6S1ORF
• ATPase, H+ transporting, lysosomal (vacuolar proton pump), subunit 1
• ATPase, H+ transporting, lysosomal accessory protein 1
• H+ transporting, lysosomal interacting protein 1
• H-ATPase subunit
• MGC129781
• Protein XAP-3
• Vacuolar proton pump subunit S1
• VATPS1V-ATPase Ac45 subunit
• V-type proton ATPase subunit S1
• XAP-3
• XAP3V-ATPase S1 accessory protein

Background

This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6AP1
• Uniprot:
  • Q15904(Human)