ATG9B Antibody - Azide and BSA Free

Western Blot: ATG9B Antibody [NBP2-92806] - Western blot analysis of extracts of HUH-7 cells, using ATG9B antibody (NBP2-92806) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: ATG9B Antibody [NBP2-92806] - Western blot analysis of extracts of various cell lines, using ATG9B antibody (NBP2-92806) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: ATG9B Antibody - Azide and BSA Free [NBP2-92806] - Immunofluorescence analysis of human placenta cells using ATG9B Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATG9B Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ATG9B Antibody - Azide and BSA Free (NBP2-92806) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 715-924 of human ATG9B (NP_001303985.1). HPLWRPPGHSSKFLGHLWGRVQQDAAAWGATSARGPSTPGVLSNCTSPLPEAFLANLFVHPLLPPRDLSPTAPCPAAATASLLASISRIAQDPSSVSPGGTGGQKLAQLPELASAEMSLHVIYLHQLHQQQQQQEPWGEAAASILSRPCSSPSQPPSPDEEKPSWSSDGSSPASSPRQQWGTQKARNLFPGGFQVTTDTQKEPDRASCTD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATG9B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for ATG9B Antibody - Azide and BSA Free

• APG9L2APG9-like 2
• ATG9 autophagy related 9 homolog B (S. cerevisiae)
• autophagy-related protein 9B
• endothelial nitric oxide synthase antisense
• nitric oxide synthase 3 antisense
• Nitric oxide synthase 3-overlapping antisense gene protein
• NOS3ASautophagy 9-like 2 protein
• Protein sONE
• SONEFLJ14885

Background

FUNCTION: May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. SUBUNIT: Interacts with GABRG2, TUBA1, ULK1 and NSF. Interacts with beta-tubulin and GPHN. SUBCELLULAR LOCATION: Intracytoplasmic membrane. Cytoskeleton. Largely associated with intracellular membrane structures including the Golgi apparatus and post-synaptic cisternae. Colocalizes with microtubules. SIMILARITY: Belongs to the MAP1 LC3 family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for ATG9B Antibody (NBP2-92806). (Showing 1 - 1 of 1 FAQ).

1. How much is the molecular weight of ATG9B protein?
   • The predicted molecular weight of ATG9B protein is 101kDa

Bioinformatics

• Gene Symbol: ATG9B