Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free

Western Blot: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01] - Analysis of Prodynorphin/PDYN expression in transfected 293T cell line by Prodynorphin/PDYN monoclonal antibody (M01), clone 2E12.Lane 1: Prodynorphin/PDYN transfected lysate(28.4 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01] - Analysis of Prodynorphin/PDYN transfected lysate using anti-Prodynorphin/PDYN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with Prodynorphin/PDYN MaxPab rabbit polyclonal antibody.

Sandwich ELISA: Prodynorphin/PDYN Antibody (2E12) [H00005173-M01] - Detection limit for recombinant GST tagged Prodynorphin/PDYN is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 2E12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: Prodynorphin/PDYN (NP_077722.1, 205 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA
• Specificity: PDYN - prodynorphin (2E12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PDYN
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Prodynorphin/PDYN Antibody (2E12) - Azide and BSA Free

• ADCA
• Beta-neoendorphin-dynorphin
• leu-enkephalin
• leumorphin
• neoendorphin-dynorphin-enkephalin prepropeptide
• PENKB
• preprodynorphin
• preproenkephalin B
• proenkephalin-B
• rimorphin
• SCA23

Background

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for Prodynorphin/PDYN Antibody (H00005173-M01) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 11/23/2021

Summary

• Application: Western Blot
• Sample Tested: Brain tissue lysate
• Species: Human
• Lot: 2E12

Bioinformatics

• Gene Symbol: PDYN
• Entrez:
  • 5173(Human)
• Uniprot:
  • NP_077722(Human)