PPP2R2B Antibody

Images

 
Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: PPP2R2B Antibody [NBP2-46667] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PPP2R2B Antibody [NBP2-46667] - Staining of human cerebral cortex shows distinct cytoplasmic and nuclear positivity in neuronal cells.
Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG, Lane 4: Human plasma, Lane 5: Human Liver tissue, ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP2R2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
Specificity
Specificity of human PPP2R2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
PPP2R2B Knockout HeLa Cell Lysate
Control Peptide
PPP2R2B Recombinant Protein Antigen (NBP2-46667PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP2R2B Antibody

  • B55BETA
  • FLJ95686
  • MGC24888
  • PP2A subunit B isoform B55-beta
  • PP2A subunit B isoform beta
  • PP2A subunit B isoform PR55-beta
  • PP2A subunit B isoform R2-beta
  • PP2A, subunit B, B-beta isoform
  • PP2AB55BETA
  • PP2ABBETA
  • PP2APR55B
  • PP2APR55BETA
  • PR2AB55BETA
  • PR2ABBETA
  • PR2APR55BETA
  • PR52B
  • PR55BETA
  • PR55-BETA
  • protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform
  • protein phosphatase 2, regulatory subunit B, beta
  • SCA12
  • serine/threonine protein phosphatase 2A, 55 kDa regulatory subunit B, betaisoform
  • serine/threonine protein phosphatase 2A, neuronal isoform
  • serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B betaisoform
  • spinocerebellar ataxia 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-58916
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-58346
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-93821
Species: Hu, Rt
Applications: WB
NBP3-04588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00003748-M01
Species: Hu, Mu, Rb
Applications: WB, ELISA, ICC/IF
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPP2R2B Antibody (NBP2-46667) (0)

There are no publications for PPP2R2B Antibody (NBP2-46667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R2B Antibody (NBP2-46667) (0)

There are no reviews for PPP2R2B Antibody (NBP2-46667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPP2R2B Antibody (NBP2-46667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PPP2R2B Products

Bioinformatics Tool for PPP2R2B Antibody (NBP2-46667)

Discover related pathways, diseases and genes to PPP2R2B Antibody (NBP2-46667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R2B Antibody (NBP2-46667)

Discover more about diseases related to PPP2R2B Antibody (NBP2-46667).
 

Pathways for PPP2R2B Antibody (NBP2-46667)

View related products by pathway.

PTMs for PPP2R2B Antibody (NBP2-46667)

Learn more about PTMs related to PPP2R2B Antibody (NBP2-46667).
 

Research Areas for PPP2R2B Antibody (NBP2-46667)

Find related products by research area.

Blogs on PPP2R2B

There are no specific blogs for PPP2R2B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R2B
Entrez
Uniprot