Puratrophin-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Puratrophin-1 Antibody [NBP2-56984] - Staining of human cell line CACO-2 shows localization to cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Puratrophin-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRASIAVAPFDHDSLYLGASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPSFP
Specificity
Specificity of human Puratrophin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHG4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Puratrophin-1 Antibody

  • ARHGEF44
  • DKFZP434I216
  • PH domain-containing family G member 4
  • pleckstrin homology domain containing, family G (with RhoGef domain) member 4
  • Pleckstrin homology domain-containing family G member 4
  • PRTPHN1
  • puratrophin-1
  • Purkinje cell atrophy associated protein 1
  • Purkinje cell atrophy-associated protein 1
  • SCA4
  • spinocerebellar ataxia 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38049PEP
Species: Hu
Applications: AC
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59668
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: WB, IP
NBP1-91500
Species: Hu, Mu, Rt
Applications: WB
NBP1-57356
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, ChIP, CHIP-SEQ, KD
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30872
Species: Hu
Applications: IHC, IHC-P
NB120-5908
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69006
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Sh, Ze
Applications: WB
NBP1-58916
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ChIP, ICC/IF, ChIP
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-92505
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67199
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Puratrophin-1 Antibody (NBP2-56984) (0)

There are no publications for Puratrophin-1 Antibody (NBP2-56984).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Puratrophin-1 Antibody (NBP2-56984) (0)

There are no reviews for Puratrophin-1 Antibody (NBP2-56984). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Puratrophin-1 Antibody (NBP2-56984) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Puratrophin-1 Products

Bioinformatics Tool for Puratrophin-1 Antibody (NBP2-56984)

Discover related pathways, diseases and genes to Puratrophin-1 Antibody (NBP2-56984). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Puratrophin-1 Antibody (NBP2-56984)

Discover more about diseases related to Puratrophin-1 Antibody (NBP2-56984).
 

Pathways for Puratrophin-1 Antibody (NBP2-56984)

View related products by pathway.

Blogs on Puratrophin-1

There are no specific blogs for Puratrophin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Puratrophin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHG4